(data stored in ACNUC30630 zone)

EMBL: CP002010.PE583

CP002010.PE583       Location/Qualifiers
FT   CDS_pept        complement(755380..756186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0608"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00083"
FT                   /db_xref="GOA:D6ZT77"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT77"
FT                   /protein_id="ADH00083.1"
FT                   /translation="MIRKTSPVSQGLWAALALIVTVLVMLPVLYIYVGAFFFDANGLFK
FT                   GFTLGNFMRAMSQMPLTQQLGNSIVVTVCQTAGQIVTAFLAAYAIVFCNLRRPGMWMMV
FT                   FLMSMMVPGETTLLSNYLNIANWGLMDTIPAIFLPFLVQGFTVFLFRQAFRSFPKELRE
FT                   ASLIDGAGHLQFMIDVLLPIVKPTIIAATINAMVAAWNGYFWPLLVTNKPEHRTIQVGI
FT                   TQLSGTDGSNIGVVLAGAAIAVVPAMILTLLFNRSLRGMSVAGSIK"
     atgatccgca agacctcccc cgtgagccag ggcctgtggg ccgcgctggc cctgatcgtg        60
     accgtgctgg tcatgctgcc ggttctgtac atctacgtcg gcgcgttctt cttcgacgcc       120
     aacggcctgt tcaagggctt caccctgggc aatttcatgc gcgccatgtc ccagatgccc       180
     ctgacccagc agctgggcaa cagcatcgtc gtgaccgtct gccagaccgc gggccagatc       240
     gtgaccgcgt tcctcgccgc ctacgccatc gtgttctgca atctgaggcg gcccggaatg       300
     tggatgatgg tcttcctcat gagcatgatg gtgcctggcg agaccaccct gctgtcgaac       360
     tacctgaaca tcgcaaactg gggactcatg gacacgatcc cggcgatctt cctgccgttc       420
     ctggtgcagg gcttcaccgt gttcctgttc cgccaggcgt tccgttcctt ccccaaggag       480
     ctgcgcgagg catcgctgat cgacggcgcc ggccatctgc agttcatgat cgacgtgctc       540
     ctgcccatcg tcaagccgac catcatcgcc gcgacgatca acgccatggt cgccgcatgg       600
     aacggctact tctggcccct gctcgtgacc aacaagcccg agcaccgcac cattcaggtc       660
     ggcatcaccc agctgagcgg caccgacggc tccaacatcg gcgtggtcct ggccggcgcg       720
     gccatcgcgg tcgtcccggc gatgatcctc acgctcctgt tcaaccggtc cctgcgcggc       780
     atgagcgtcg ccggaagcat caagtag                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page