(data stored in ACNUC30630 zone)

EMBL: CP002010.PE60

CP002010.PE60        Location/Qualifiers
FT   CDS_pept        84249..85430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0063"
FT                   /product="TelA-like protein associated with cryptic
FT                   tellurite resistance"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99559"
FT                   /db_xref="InterPro:IPR008863"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXB3"
FT                   /protein_id="ADG99559.1"
FT                   /translation="MPQNITLADLTKSSATPITNPLLNTNQAAPNTTLVPTAAEAQAAA
FT                   ALTPDQQIAKLPEADQATVNQMAGQIDFTRDGIESSYGKDAQRATSTFADEILSDTRSK
FT                   DTGEAGELLNTMLVTIDEADLGGFRTIPIIGQVAVSVDKLRRRYQKVDAQIDEIIVRLE
FT                   SAQAKLVADISMYDTMYTQNAQQYRELKMTVLAGKKALADFNANQLPALEAEAAASGDA
FT                   MQAQVLKDFKSKLDRFAKRLDDLDRISVVTLQTAPQIKIIQNADQTIVDKIDTTISTTI
FT                   PVWKSQMVIALGLSNQRKALDLQNKADDVTNKLLARNAAALHKGAVDAEKANQRSVVEI
FT                   DTLEKINAELIATLKETVQIQKEGKANREAAQVKMRQIESDLKNALLENAQQM"
     atgccccaaa acatcaccct cgcagacctc accaaaagct ccgcaacccc catcaccaac        60
     ccgttactca acaccaacca agccgccccc aacaccaccc tcgtccccac cgccgccgaa       120
     gcccaagccg ccgcggccct gaccccggac cagcagatcg ccaaattgcc cgaagccgac       180
     caggccacgg tcaaccagat ggccggccag atcgacttca ctcgcgacgg catcgaatcc       240
     agctacggca aggacgccca gcgcgccacc tccaccttcg ccgacgaaat cctctccgac       300
     acccgctcca aagacaccgg cgaggcgggc gaactactga acaccatgct ggtcaccatt       360
     gacgaggctg acctcggcgg cttccgcacc attccgatca tcggccaggt ggccgtcagc       420
     gtggataagc tgcgccgccg ctatcagaaa gtcgacgcgc aaatcgacga aatcatcgtg       480
     cgtctcgaat ccgcgcaagc caaactcgtg gccgacatct ccatgtacga cacgatgtac       540
     acgcagaacg cccagcaata ccgcgagctg aaaatgaccg tactggccgg caagaaggcg       600
     ctcgccgact tcaacgccaa ccagctgcca gcgctggagg ccgaggccgc cgccagtggc       660
     gacgccatgc aggcgcaagt gctgaaggac ttcaagtcca agctcgaccg ttttgccaag       720
     cgactcgacg acctcgaccg catcagcgtg gtcaccttgc agaccgcgcc gcagatcaaa       780
     atcatccaga acgcggacca gaccatcgtg gacaagatcg acaccaccat ctccaccacg       840
     attccggtgt ggaagagcca gatggtgatc gcgctgggcc tgtccaacca gcgcaaggcc       900
     ctcgacctgc agaacaaggc cgacgatgtg accaacaagc tgctggcgcg taacgcggcc       960
     gccctgcaca agggtgcggt ggacgcggaa aaggccaacc agcgttccgt ggtggaaatc      1020
     gacacgctgg agaagatcaa cgccgaactc atcgccaccc tgaaggagac cgtgcagatc      1080
     cagaaggaag gcaaggccaa ccgcgaggcc gcccaggtca agatgcgcca aatcgagtcc      1140
     gacctcaaaa acgccttgct cgaaaacgcc cagcagatgt ga                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page