(data stored in ACNUC30630 zone)

EMBL: CP002010.PE602

CP002010.PE602       Location/Qualifiers
FT   CDS_pept        complement(777799..778422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00102"
FT                   /db_xref="GOA:D6ZT96"
FT                   /db_xref="InterPro:IPR021403"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT96"
FT                   /protein_id="ADH00102.1"
FT                   /translation="MTWNPFRKKEEAQVPVEQAPKKAADPSEKKGRPTPKMKQAQAAGI
FT                   RPLVPVDRKASAKAAKARLRERENAEYEAMQKGDINHMPKSERLPWRIYIRDYVDARFN
FT                   LGEWFIPVAFAILIVSMFVTSLMQNQWASIIMMALMYGYLIAVIIDVWLMWRKLKAKLI
FT                   AKYGEQSVSKGSRSFSYAWSRSIQMRRWRLPKPRYPKRGHWPAD"
     atgacatgga atccgtttag gaaaaaagaa gaggcccaag ttcccgttga gcaggccccg        60
     aagaaggccg ccgatccttc tgagaaaaaa ggccgtccta ccccgaagat gaagcaggct       120
     caggccgccg gtatccgtcc gctggttccg gtggaccgca aggccagcgc caaggccgcc       180
     aaagcccgtc tgcgcgagag ggagaacgcc gagtacgagg cgatgcagaa gggcgacatc       240
     aaccacatgc ccaagtcgga acgcctgcct tggcgtatct acatccgtga ttatgtggat       300
     gcccgtttca accttggcga atggttcatc ccggtggcct tcgcgattct gatcgtctcc       360
     atgttcgtca cttctttgat gcagaaccag tgggcttcca tcatcatgat ggcgcttatg       420
     tacggttacc tgattgccgt gatcatcgac gtatggctga tgtggcgcaa gctcaaggcc       480
     aagctcatcg ccaagtacgg cgaacagtcc gtgtccaagg gctcccgctc cttctcctac       540
     gcttggagcc gttcgattca gatgcgtcgt tggaggcttc ccaagccgcg ttacccgaag       600
     cgcggtcact ggccggcaga ctga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page