(data stored in ACNUC30630 zone)

EMBL: CP002010.PE610

CP002010.PE610       Location/Qualifiers
FT   CDS_pept        787850..788536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00110"
FT                   /db_xref="GOA:D6ZTA4"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTA4"
FT                   /protein_id="ADH00110.1"
FT                   /translation="MSQPEQDKPKYGQYQQPEYGAMSGQYGPNYNPYIYGAPEPDTKKD
FT                   SAAAAGNNGGAAQSQQAGQPYGQQPAWPGNQQAGGWPYAQGGQQSGPGAYPGGYPGMQG
FT                   QSYGQQPNGQPHQPHYYHGIDLNDPNQNPLYGHWDSYAIISFILALFFPVPVLSALMGA
FT                   VAMWRTRTFHMKGFGLAVAAVVINVLYTIAVIWMAFNGYDAMSLYQEALQQLTGGTGSS
FT                   SDSISA"
     atgagccaac cggagcagga caagccgaaa tacgggcagt accagcagcc tgaatatggt        60
     gctatgtctg gccaatacgg gccgaattac aacccgtata tttatggcgc tcccgagccg       120
     gataccaaaa aggattccgc cgcagccgct ggcaacaacg gtggcgcggc gcaatcccag       180
     caggccggcc agccgtacgg tcagcagccg gcgtggcccg gcaatcagca ggcgggcggc       240
     tggccgtatg ctcaaggcgg ccaacagtcc ggtccgggcg catatccggg cgggtacccg       300
     ggcatgcagg ggcagtcgta tggtcaacag ccgaacggtc agcctcacca gccgcattat       360
     taccacggca tcgacctgaa cgatccaaac cagaacccac tctacgggca ctgggattcg       420
     tatgcgatca tctcctttat cctcgccctg ttcttcccgg tgccagtgct ctcggcactg       480
     atgggcgcgg tggcaatgtg gcgcacgcgc accttccata tgaaaggctt cggtttggct       540
     gtggccgccg tggtgatcaa cgtgctgtac accatcgccg tcatctggat ggccttcaat       600
     ggctatgacg ccatgagcct ctaccaggaa gccctccagc aactcaccgg cggcaccggc       660
     tcctcctccg actccatctc cgcataa                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page