(data stored in ACNUC30630 zone)

EMBL: CP002010.PE624

CP002010.PE624       Location/Qualifiers
FT   CDS_pept        801177..801944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0649"
FT                   /product="Hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00124"
FT                   /db_xref="GOA:D6ZTB8"
FT                   /db_xref="InterPro:IPR010540"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTB8"
FT                   /protein_id="ADH00124.1"
FT                   /translation="MIITLEHYFLWFLFYSFVGWMYESILVSCQQHRLVNRGFLNGPLC
FT                   PIYGTGAILGVAILGNVHNPIIIFLISMVGATILEYTTSWVMEQLFHARWWDYSNFRFN
FT                   LQGRVCLLGALIFGLGGVGVVLGSQPYVERVTDMIPLPMLHTLVTVLALITIIDLAVTV
FT                   AGMLGFEQVLDSVSQVVQDVAARAGGTWQWGSRAVSDRMRELSQDTVERLRWAINGVIN
FT                   AQQKRMLKSFPKFQVPDRQDIIDSLRELMGPRR"
     atgatcatca cactcgaaca ttatttcctc tggtttctgt tctacagttt cgtcggctgg        60
     atgtacgaat ccattctcgt ctcctgccaa cagcaccgct tggtcaaccg agggttcctc       120
     aacggcccgc tgtgcccgat ctacggcacc ggcgcgatac tcggcgtcgc cattctcggc       180
     aacgtacata acccgatcat catcttcctg atttcgatgg tgggcgccac gatactcgaa       240
     tacacaacct cgtgggtcat ggagcagctg ttccacgccc gctggtggga ttactcgaat       300
     ttccgcttca acctccaagg ccgcgtctgc ctgctgggcg cgttgatttt cggtctcggc       360
     ggcgtgggcg tggtacttgg ttcgcagcca tatgtcgagc gggtcacgga tatgattccg       420
     ctgccgatgc tgcatacgct ggtcacggta ctggccctga tcaccatcat cgacttggcg       480
     gtcacggttg cgggcatgct cggattcgag caggtgctcg attccgtctc tcaggtggtg       540
     caggatgtgg cggcacgcgc cggtggcacg tggcagtggg gctcccgtgc ggtatccgac       600
     aggatgcgtg agctttcgca ggatacggtt gagcgtctgc gctgggccat caatggcgtc       660
     atcaacgcac agcagaagcg tatgctcaag tccttcccga agttccaggt gccggatcgt       720
     caggacatca tcgactcttt gcgcgaactt atgggcccgc gccgctag                    768
//

If you have problems or comments...

PBIL Back to PBIL home page