(data stored in ACNUC30630 zone)

EMBL: CP002010.PE626

CP002010.PE626       Location/Qualifiers
FT   CDS_pept        803420..805312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0651"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00126"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTC0"
FT                   /protein_id="ADH00126.1"
FT                   /translation="MAEGNERSGKSYGGGHKGYGDRRPGNRGGKGFKPRGKGGFKPRHD
FT                   GEGFKPRRDGDGEGHGGYRKSYGKGGDFHKGGRSGFGGKGGYRGNGPRRDGDGFRPRRD
FT                   RDGEGFKPRRREDGEGYAPRRDGDGEGHGGYRKSYGKSGGFHKGGYRGSGPRRDGEGFK
FT                   PRREGGYRSHEGENGENPRYQHRDNDRRDFRRDDRRDFHRDGERRDFRRDNDRRDFRRD
FT                   DRRDNDRRDFHRDGERRNFRRDDDRRDGDRRNFRRDDRRDNNRRDGEFREFSQEEKRQY
FT                   REEKRSEYMRRPRRNSDGTMSFPSQNPYTDRRPDEPKMPKGMEWSMLSKDERERLRGLS
FT                   KEHAENIGLHILAAFALEESDPELALEHAKWVARQASRIDFARETLAFVAYRQGDYKLS
FT                   LREFRTAYRMNGFLDYLPFIADCERGVGEPKKAVELALSDEGKQLHGAPKVEMFLVYAG
FT                   ALGDLEMWDKAIEVVHTVGRSQGLPGEYRMRAVQAEQYFLEEAGRSKEAEQLNDLLDRL
FT                   EDQYADEEIDENSDDVVIDHDLEDITDDSDVLEKLGIDPDEAQYAPDLEQEYGDEDDEA
FT                   EDGDAESDEADVENAESEDASEESEESEAEESSESADDAVEPAESDETETETEE"
     atggcagaag gtaacgagcg ttccggcaag tcctacggcg gcggccataa ggggtatggc        60
     gatcgccgac cgggcaaccg cggcggcaag ggtttcaagc cgcgcggcaa gggcggtttc       120
     aagccgcgtc atgacggtga aggtttcaag ccgcgccgtg atggtgatgg cgagggccac       180
     ggcggctacc gcaagtcgta cggcaagggt ggcgacttcc acaagggcgg ccgctctggt       240
     ttcggtggca agggcggcta tcgcggcaac ggtccgcgcc gcgatggcga cggcttccgt       300
     ccgcgccgcg accgcgatgg cgagggcttc aagccgcgcc gccgtgagga tggtgagggt       360
     tacgcgccgc gccgtgatgg tgatggcgag ggccacggcg gctaccgtaa gtcgtacggc       420
     aagtccggtg gcttccacaa gggtggttac cgcggcagtg gtccgcgccg tgacggtgaa       480
     ggtttcaagc cgcgccgcga aggcggctac cgttcccacg aaggcgagaa cggcgagaac       540
     ccgcgctacc agcaccgtga caacgatcgt cgtgatttcc gtcgcgatga tcgccgtgac       600
     ttccaccgcg atggtgagcg tcgtgacttc cgtcgtgaca atgatcgtcg tgacttccgc       660
     cgcgatgacc gaagggataa cgatcgccgt gatttccatc gtgatggtga gcgtcgcaac       720
     ttccgccgcg acgacgatcg ccgtgatggc gatcgccgca acttccgcag ggacgaccgc       780
     cgcgacaaca accgtcgtga cggcgaattc cgcgagtttt cgcaggaaga gaagcgccag       840
     taccgtgagg agaagcgctc tgaatacatg aggcgtccgc gccgtaactc cgacggcacg       900
     atgagcttcc cctcgcagaa cccgtacacc gaccgtcgtc ccgacgagcc caagatgccc       960
     aagggcatgg aatggtcgat gctgtccaag gatgagcgcg aacgtctgcg cggcctgtcc      1020
     aaggagcatg cggagaacat tggtctgcac atcctcgccg ctttcgcgct ggaggagagc      1080
     gatcccgaac ttgccttgga gcacgccaag tgggtggccc gtcaggcctc ccgcatcgac      1140
     tttgcccgcg agacgctcgc gttcgtggcc taccgtcagg gcgactacaa gctgtccctg      1200
     cgtgagttcc gtaccgccta ccgtatgaac ggcttcctcg actacctgcc gttcatcgct      1260
     gactgcgagc gtggtgtcgg tgaaccgaag aaggccgtgg aactggcgct gtccgatgag      1320
     ggcaagcagc tgcatggcgc tcccaaggtc gagatgttcc tggtgtatgc cggtgccctt      1380
     ggcgatttgg agatgtggga caaggccatt gaagtggttc ataccgtcgg ccgctctcag      1440
     ggtcttccgg gtgagtaccg tatgcgtgcc gtgcaggccg agcagtactt ccttgaagag      1500
     gccggccgca gcaaggaagc cgagcagctt aatgacctgc tggaccgtct tgaggatcag      1560
     tatgccgacg aggagattga cgaaaacagc gacgacgtgg tgattgacca cgatctcgaa      1620
     gacatcaccg acgactccga cgtgctcgag aagctcggca tcgatccgga cgaggcgcag      1680
     tacgccccgg atctggagca ggaatacggc gatgaggacg acgaggctga agacggcgat      1740
     gccgagtctg atgaggccga tgtcgaaaat gctgagtccg aggatgcatc ggaagaatct      1800
     gaggaatctg aagccgagga gtcttccgag tccgctgacg atgccgttga accggctgag      1860
     tccgacgaga ccgagaccga aaccgaggag tga                                   1893
//

If you have problems or comments...

PBIL Back to PBIL home page