(data stored in ACNUC30630 zone)

EMBL: CP002010.PE637

CP002010.PE637       Location/Qualifiers
FT   CDS_pept        814697..815623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0662"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00137"
FT                   /db_xref="GOA:D6ZTD1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTD1"
FT                   /protein_id="ADH00137.1"
FT                   /translation="MAMTSISESDAMALQVTDVTKHYDSGFTLDDVTFDLPKGYIMGLI
FT                   GPNGAGKSTLIKLILNMIHRDAGSIHVLGLDNIANEEPVKEQLGVVFDFSYMHEQWQVK
FT                   NIERIVAPLYPSWDGGCYHKYLDTFGLGDAQNGKKHIKDLSRGMQMKLMLAIALSHDAK
FT                   LLILDEPTSGLDVLARDELMDILHAYIEDGEHSVLFSTHITADLERAADFITYITDGRL
FT                   YYTGPKDEFEESFRLIKGGPDELAQLPADVVLGSHTYATGFDALVRSDRLDAVASVVSG
FT                   LVVESASIDDIIRLTNAHDSNRDLSGR"
     atggccatga cctccatatc cgaatccgac gcgatggcgt tgcaggtcac cgacgtcacc        60
     aaacactatg attccggctt cacgctggac gacgtgacct tcgacctgcc caagggctac       120
     atcatgggac tgatcggccc gaacggcgcc ggcaaatcca ccctcatcaa actcatcctc       180
     aacatgatcc accgcgacgc cggttcgatt cacgtgctcg gcctcgacaa catcgccaac       240
     gaggagcccg tcaaagaaca actcggcgtg gtgttcgact tcagctacat gcatgaacag       300
     tggcaagtca agaacattga acgtattgtc gcgccactgt atccatcatg ggacggtgga       360
     tgctatcaca agtatctgga tacttttggc cttggtgacg cacagaacgg caagaaacat       420
     atcaaggatc tttcccgcgg catgcagatg aagctgatgc tggccatcgc attgagtcat       480
     gatgccaagc tgctgattct cgacgagccg accagcggac tcgatgtgct tgcccgcgac       540
     gaactcatgg atatcctgca tgcctacatt gaggatggcg aacattcggt actgttcagc       600
     acccatatca ctgccgacct cgaacgtgct gctgacttca ttacctacat caccgatggc       660
     cgtctctact acaccggtcc gaaagacgag tttgaggaat cgttccgcct gattaagggc       720
     ggtccagacg aactggcaca actgcctgcg gacgtagtgc tgggctcaca tacgtatgcc       780
     accggattcg atgcgctggt ccggtcagac aggcttgatg ctgttgcatc ggtggtttcg       840
     gggcttgtcg ttgaatcggc ttccattgat gacatcattc gactgaccaa tgcccatgat       900
     tccaatcgtg acttgagcgg gaggtga                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page