(data stored in ACNUC30630 zone)

EMBL: CP002010.PE638

CP002010.PE638       Location/Qualifiers
FT   CDS_pept        815630..816343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0663"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00138"
FT                   /db_xref="GOA:D6ZTD2"
FT                   /db_xref="InterPro:IPR025699"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTD2"
FT                   /protein_id="ADH00138.1"
FT                   /translation="MEAILRVSRSRQHALTTALRVDMAYLCVGERTVFSLLLAPLFSVI
FT                   FQGEAYGDGFGYRMGVIMTVFTCAMWVLTMAVADLQNGYRLRGIIPASRKSQVAARYVV
FT                   GLVISVLSIAMIVLIDGLQVLVNPDWSFAGNLWAAPLGGFWTALMVALIVPTGYLWTKL
FT                   GGLQVTMMVIYVVVLAGFILLSILPASVTRGLAHAANAIIAQRLWLVIAVLATTVVAYG
FT                   ISYVIASRIFASREW"
     atggaggcaa tactgagggt gtcgcggtct cggcaacatg cattgaccac tgcattgcgc        60
     gtcgatatgg cctacctgtg cgtcggcgaa cggactgtgt tctcgttgtt gttggcaccg       120
     ttgttctccg tcatctttca aggtgaagct tatggggatg gcttcggcta tcgcatgggt       180
     gtcatcatga cggtattcac ctgcgccatg tgggtgctga ccatggcggt tgctgactta       240
     cagaacggat atcgacttcg tggcattatt ccggcttcga ggaagagtca ggtggccgcg       300
     cgatatgtgg ttggattggt gatttccgta ttgtcgatag cgatgattgt tctgattgac       360
     gggttgcaag tgctggtcaa tccggattgg tcattcgcgg gcaatctgtg ggcggctccg       420
     ttgggaggtt tctggaccgc gctgatggtc gcgcttatcg tgcccacggg ttatctgtgg       480
     accaaactag gcggtcttca agtcacgatg atggtgattt atgtcgttgt attggctgga       540
     ttcatactgc tatctatttt gcctgcttcg gtgaccagag gattggccca tgccgcgaat       600
     gccatcatcg cgcaacgatt gtggctggtt attgcggtat tggcaacgac ggttgtggca       660
     tatggaatct cgtatgtaat tgcctctcgc atatttgctt caagggaatg gtga             714
//

If you have problems or comments...

PBIL Back to PBIL home page