(data stored in ACNUC30630 zone)

EMBL: CP002010.PE642

CP002010.PE642       Location/Qualifiers
FT   CDS_pept        820229..821374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0669"
FT                   /product="protein of unknown function DUF1648"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00142"
FT                   /db_xref="GOA:D6ZTD6"
FT                   /db_xref="InterPro:IPR012867"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTD6"
FT                   /protein_id="ADH00142.1"
FT                   /translation="MNNTVVSMNIALCAFLLLPVIVTAGLAGVPWVTDRHEVFGVTVPA
FT                   AAHTNTRIREYKVAFSGIVVAIGVCAMLVSLAVWRLCGVDAAFWTVSIAAVVIAICGFV
FT                   LQQVFRRKVLSIKTSQGWEASSARRAALIGERDNPDPLSLKWELLQVVCLAVTIAVGLL
FT                   GYDRMPERVPIHADIAGNVNGWAEKSPMVIWYAVLAQVVLAAVMVASHVAIIYAKHPID
FT                   PDHPATTGYAYGVFSRVWSIYVLVIGLLTAGGLGLGVQLVAIGVLDVNLIGLIGMFIAV
FT                   AALVGALMIGMYYGQNGARVYAGVRHSDGGDDLDDDVMPYDDDLHWIGGIIYINRDDPA
FT                   IMVPKRFGVGWTVNLARPSVIIGTIVLLAIAIGLPVAAILM"
     atgaacaata cagtcgtgtc gatgaacatc gcgttgtgtg cgttcttgct gttgccggtg        60
     atagtgaccg ccggcttggc aggggttcca tgggttaccg accggcatga ggtgttcggt       120
     gtcacggtgc cggccgccgc ccataccaat acgcgcattc gcgaatacaa agtcgcgttt       180
     tcgggaattg tagtggcaat cggtgtgtgc gccatgctgg tctcgttggc cgtctggcgg       240
     ctctgtggag tcgacgcggc gttctggacc gtgtccatcg cagcggtggt gattgcgata       300
     tgtggttttg tgctgcagca ggtgtttcgc cgcaaagtac tgtccatcaa aaccagtcag       360
     ggatgggagg cgtccagtgc tcgccgtgcg gcattgatag gtgagcggga caatcccgac       420
     ccgctgagcc tgaagtggga attgctgcaa gtcgtttgtc tcgctgtcac cattgcggtc       480
     gggctgctgg gctatgaccg gatgccggag cgggtgccga ttcatgcgga tatcgccggc       540
     aatgtgaacg gctgggccga gaagagtccg atggtgattt ggtacgccgt gctcgcgcag       600
     gtggtgctgg cagcggtgat ggtggccagc catgtcgcga tcatctacgc caagcacccg       660
     attgatcccg accaccccgc caccaccggg tatgcctatg gtgtgttctc gcgggtctgg       720
     agcatctacg tgctggtcat cggactgctg acagccggtg gattgggcct aggcgttcag       780
     cttgtcgcca ttggcgtgct ggatgtcaat ctaatcggcc taatcggcat gttcatcgct       840
     gtggcggctc tggtcggcgc gctgatgatc ggcatgtatt acgggcagaa cggggcgcgc       900
     gtctatgccg gtgttcggca cagtgacggc ggtgacgatt tggacgatga tgttatgccg       960
     tatgacgatg acctgcactg gattggcggc atcatctaca tcaaccgtga cgatccggcc      1020
     atcatggttc ctaaacgttt cggcgtcggc tggaccgtca acctcgcacg ccccagcgtg      1080
     atcatcggca ctatcgtgct gttggcaatc gccataggac tgccagtcgc cgcgatactg      1140
     atgtaa                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page