(data stored in ACNUC30630 zone)

EMBL: CP002010.PE646

CP002010.PE646       Location/Qualifiers
FT   CDS_pept        825957..826520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0673"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00146"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTE0"
FT                   /protein_id="ADH00146.1"
FT                   /translation="MNTTADTANKASELRPDIDLNDPKLGLKIAAERLSIVRYVFLVQI
FT                   EDGIASAAQRASLEYADAVLIGWPETDSPEVVDLNDAQLKIVREHMELMEGYIGKYSQM
FT                   EHDGDLDGMTDTLIRITERVAEVRRLYQPDFPLPTFAEIRRVVQDEWDEDMGKIDPKED
FT                   NPSAGEIEEETESADDAAGEGGQA"
     atgaacacta cggctgacac ggcaaacaag gcaagcgaac tgcggcccga catcgacctc        60
     aacgatccca agctcggcct gaagatcgcg gccgaacggc tcagcatcgt ccgctatgtg       120
     ttcctcgtgc agattgagga cggcatcgcc tccgccgccc agcgtgcgtc gctcgaatac       180
     gcggacgccg tgctcatcgg ctggcccgag accgattcac ccgaagtcgt ggacctcaac       240
     gatgcccagc tcaagatcgt gcgcgaacac atggaactca tggaaggcta catcggcaaa       300
     tacagccaga tggagcacga cggcgacctc gacggcatga ccgacacgct catccgcatc       360
     accgagcgcg tggccgaggt ccgccgcctc taccagccgg acttcccgct gcccaccttc       420
     gccgagattc gtcgcgtggt ccaagacgaa tgggatgaag acatgggcaa gatcgatccc       480
     aaggaagaca atccctccgc cggcgaaatc gaagaggaaa ccgaatcagc cgatgacgcc       540
     gccggcgagg gcggccaggc atga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page