(data stored in ACNUC30630 zone)

EMBL: CP002010.PE65

CP002010.PE65        Location/Qualifiers
FT   CDS_pept        89975..92659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0068"
FT                   /product="protein of unknown function DUF470"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99564"
FT                   /db_xref="GOA:D6ZXB8"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXB8"
FT                   /protein_id="ADG99564.1"
FT                   /translation="MSEEQQHGNARPAAMPQTRRPLRDAEPSRTKPATTSRATKPHTAR
FT                   SSHAAESWRELAGDVRQWADDHRLAVTATATLVALNLAAWLVAAMAGFAFPLRLSTSMA
FT                   AFNAGKLICSLFLARGVIQLMVDAVLWLVMLSIAEPWLGRVRTVVTALACAAGGVLAGL
FT                   TLCAAAGWMFQDSLFVSRMRFALSPLVLPVGALMAASAFCSHLWRRRIRLVGYVAILVT
FT                   LLYSGNPSGYCILAAALIGHAAGRVMAGPPAHVETEWHWLRSTSFEARRIFAAIAVVLA
FT                   LGPVIAITSHNHAGPLSTIGLLMSPVSVDDGMLAECLAGDTHSGCFLQFDLLRASMPGA
FT                   VLRSLLPTAVTLVLAWGLYRGRRFAAICTVAINLFTVAIAVAYYLVVPLSFAPDGMASL
FT                   LQHGAIVACVANVLPPLLFAIALLAAMKHFPIRIGWCRLVGGIGAIVLAWLACAAIYLI
FT                   YGIAQPATFSPRATASSLLAELPGRFLPIGFLSHMKLSFVPRTPMASIMYQGVGLVFWI
FT                   VVLAVVIHWMGDVSESNERARARAERLVETGGESMSFMTTWEGNSYWLSPTGRSAVAYR
FT                   VLNGIALTCTGPFGDPAEWMDDLNGFAQHCAERSLSPVFYGVHREQRDALLEAGWNSIE
FT                   VGSEMVVDPRGWKTTGKKWQDVRTAINKAKRDGVTDVQSTFLEASLDVREQIEDISEEW
FT                   AQLKALPEMKFTLGGVEELRDPRVRLLYAIDADGRVLGVTSWLPTWRDGRIVGWTLDFM
FT                   RHRTDSPNGIMEFLIARMAERLRDEGEADPAHAVEFMSLSAAPLAGMNPDRDNAGEDGA
FT                   PASEGTQVLQHALQIVADWMEPAYGFHSLFNFKRKFQPTEAPVYVCYPDPAALPQIGLA
FT                   VVRAYVPSVTPAEVAGMLSTLRS"
     atgagcgaag aacaacagca tgggaacgcg cggccggcgg ccatgccgca gacgcggcgg        60
     cccctgcggg acgcggaacc ctcgcggacg aagcccgcca cgacctcccg cgccaccaaa       120
     ccacatacgg caaggtccag ccatgcggcg gaaagctggc gtgaactggc cggtgacgtg       180
     cggcagtggg cggacgatca ccggttggcc gtcaccgcca cggcgacgct ggtggcgctg       240
     aatctggcgg cgtggctggt ggccgcgatg gccggattcg cgtttccgct gcggctcagc       300
     accagcatgg ccgcattcaa cgccggcaaa ctcatctgct cgctgttcct ggcgcgcggc       360
     gtcatccaac tcatggtcga cgccgtcctg tggctcgtca tgctgtcgat agccgaacca       420
     tggctcggcc gtgtgcgcac cgtcgtcacc gcgctcgcct gcgcggccgg cggcgtgctg       480
     gcgggcctga ccctgtgcgc ggcggccgga tggatgttcc aggactccct gttcgtctcc       540
     cgcatgcggt tcgcattgag cccgctggtg ttgccggtcg gcgcgctcat ggcggccagc       600
     gcgttctgca gccacctatg gcgcaggcgc atccgactcg tcggctatgt ggcgatcctg       660
     gtcacgttgc tctacagcgg caaccccagc ggctactgca tactcgccgc cgcgctgatc       720
     ggccatgccg ccggccgtgt gatggccggg ccgcccgcgc acgtcgaaac cgaatggcac       780
     tggctgcgca gcacctcctt cgaggcgcgg cgcatattcg cggccatcgc cgtggtactg       840
     gccctggggc cggtcatcgc catcacctcc cataaccatg cgggcccgct cagcacgatc       900
     ggcctgctca tgagcccggt ttccgtcgac gatggcatgt tggccgaatg cctggccggt       960
     gacacgcaca gcggatgctt cctgcagttc gatctgttgc gggcctcgat gcccggcgcg      1020
     gtgctgcgct cgctgctgcc cacagccgtg accttggtgc tggcgtgggg cctgtatcgc      1080
     ggacgtcggt tcgcggccat ctgcaccgtg gccatcaacc tgttcacggt ggccatcgcc      1140
     gtcgcctact atctggtcgt gccgctgagc ttcgcgccgg acggcatggc ctccctgctg      1200
     cagcacggcg cgatcgtggc ctgcgtggcg aacgtcctgc ccccgctgct gttcgccatc      1260
     gccctgctgg cggcgatgaa acacttcccg atccgcatcg gctggtgcag gctggtcggc      1320
     ggcatcggcg ccatcgtgct ggcctggctg gcgtgcgccg ccatatacct gatatacggc      1380
     atcgcccaac ccgccacctt ctcgccacgc gctacggcct cgtcgctgct ggccgagctg      1440
     ccgggacgct tcctgcccat cggcttcctg agccatatga agctgtcgtt cgtgccgcgc      1500
     actccgatgg cctcgatcat gtaccaaggc gtcgggctgg tgttctggat cgtggtgctg      1560
     gccgtggtga tccactggat gggcgacgtg agcgaatcga acgagcgagc ccgggcgcgc      1620
     gccgaacgtc tggtcgaaac cggcggcgaa tcgatgagct tcatgaccac gtgggaaggc      1680
     aacagctact ggctgtcccc cacgggcaga tcggccgtgg cgtatcgcgt gctcaacggc      1740
     atcgccctga cctgcaccgg accgttcggc gatccggcgg aatggatgga cgatctgaac      1800
     ggtttcgccc agcactgtgc ggaacgttcg ctgtcgccgg tgttctacgg cgtgcatcgg      1860
     gaacagcgcg acgcgttgct ggaagccggc tggaactcca tcgaggtcgg cagcgaaatg      1920
     gtggtcgacc cgcgcggctg gaagacgacc ggcaagaaat ggcaggacgt gcgcaccgcc      1980
     atcaacaagg ccaagcgcga cggcgtgacc gacgtgcagt ccaccttcct ggaagcgtcg      2040
     ctcgatgtgc gcgaacagat cgaggacatc tccgaggagt gggcgcagct caaggcgctg      2100
     ccggaaatga agttcacgct cggcggcgtc gaggaactgc gcgacccgcg cgtgcggctg      2160
     ctttacgcca tcgacgcgga cgggcgcgtg ctgggcgtca ccagctggtt gcccacctgg      2220
     cgcgacgggc gcatcgtcgg ctggacgttg gatttcatgc gccatcgcac cgacagcccc      2280
     aacggcatca tggagttcct gatcgcgcgc atggccgagc gtctgcgcga cgagggcgaa      2340
     gccgatcccg cgcacgccgt ggagttcatg agcctgtccg cggcgcccct ggccggcatg      2400
     aatcccgatc gggacaacgc cggggaggac ggggcaccgg ccagcgaagg cacgcaggtg      2460
     ctccaacacg cgctgcagat cgtggccgac tggatggaac ccgcctacgg cttccactcg      2520
     ctgttcaact tcaagcgcaa gttccagccc accgaagcgc cggtctacgt gtgctacccg      2580
     gacccggcgg cgttgccgca gatcgggctc gcggtggtgc gcgcctacgt gcccagcgtg      2640
     acgcccgccg aagtggccgg catgctcagc acgctgcggt cgtga                      2685
//

If you have problems or comments...

PBIL Back to PBIL home page