(data stored in ACNUC30630 zone)

EMBL: CP002010.PE659

CP002010.PE659       Location/Qualifiers
FT   CDS_pept        841709..842275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0686"
FT                   /product="protein of unknown function DUF501"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00159"
FT                   /db_xref="InterPro:IPR007511"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTF3"
FT                   /protein_id="ADH00159.1"
FT                   /translation="MTIDIAAKAKALVDTMLAEPANDHDIDQVQRQLGRYPRGMVAVGA
FT                   RCVCGRPLAVITRPVLPGGIPFPTTCYLTGPEAVKAASHVEAAGVMQQYNDMLAADEEL
FT                   KAAYEQAHNLYLAFRHELAGRLGDSEEHIEGTSAGGMPVRVKCLHALLAQSLVMGPGVN
FT                   PIGDLVLERVKDEFDPTVCRCTLDD"
     gtgaccatcg atatcgccgc caaggccaag gcccttgtcg acaccatgct tgccgagccc        60
     gccaacgacc atgacatcga ccaggtgcag cgtcagctcg gccgataccc gcgcggcatg       120
     gtcgccgtgg gggcgcgatg cgtctgcggt aggccacttg ccgtaatcac ccgtccggtg       180
     ttgcccggcg gaatcccttt ccccaccacg tgctatctga ccggtccgga agccgtcaag       240
     gccgcctccc atgtcgaggc cgccggcgtg atgcagcaat acaacgatat gctggccgct       300
     gatgaggagc tcaaggccgc atatgagcag gcccataacc tgtatctggc attccgtcac       360
     gaactggcag gccgtcttgg cgacagtgag gagcatattg aaggcacttc ggccggtggc       420
     atgccggtgc gcgtcaagtg cctgcatgcc ctgctggccc agtccttggt tatggggccg       480
     ggcgtcaacc ccattggcga tttggtgctg gaacgcgtca aagacgagtt cgatccgacc       540
     gtctgccgtt gcacactgga cgattga                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page