(data stored in ACNUC30630 zone)

EMBL: CP002010.PE71

CP002010.PE71        Location/Qualifiers
FT   CDS_pept        99503..100093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0073"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99569"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXC4"
FT                   /protein_id="ADG99569.1"
FT                   /translation="MILRSRSMNNQDTTLQDPQAIHDPRRFCNIDPDAFDYAIGRVENV
FT                   GVDAADYCGEQEKQSVSEVRFGNGPTLGSDLSTQTSQRSLAMILVTTTPSVDGYTITNY
FT                   QGIVFGEVVSGVNMFKDLGAGLRNMFGGRSQGYEEELMRARNEAIAEMQQRAEAMGAHA
FT                   VVGVDIDYEVLGADNGMLMVTASGTAVQIARTA"
     atgattttgc gttcccgctc catgaacaac caggatacaa cgcttcaaga tccacaagcg        60
     atccacgatc ctcggcggtt ttgcaatatc gatcctgatg cttttgatta cgcgatcgga       120
     cgggtcgaaa atgtcggtgt ggacgctgcc gactattgtg gtgagcagga gaaacagtct       180
     gtttccgagg tgagattcgg gaacggtccg actctcggca gtgatttatc cacacagaca       240
     agccaaagga gcctcgccat gatcctcgtc accaccaccc cgtccgtcga cggatacacc       300
     atcaccaatt accagggcat cgtcttcggc gaagtggtat ccggtgtgaa catgttcaag       360
     gatcttggcg cgggcctgcg taacatgttc ggcggccgca gccagggcta tgaggaagag       420
     ctgatgcgtg cccgcaacga ggccatcgcc gagatgcagc agcgtgcgga ggcgatgggg       480
     gcgcacgccg tggtcggcgt ggacatcgac tacgaggtgc tcggcgccga caacggcatg       540
     ctgatggtca ccgcgtccgg caccgccgtg cagatcgcgc gtacggcctg a                591
//

If you have problems or comments...

PBIL Back to PBIL home page