(data stored in ACNUC30630 zone)

EMBL: CP002010.PE87

CP002010.PE87        Location/Qualifiers
FT   CDS_pept        122157..122552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0093"
FT                   /product="Camphor resistance CrcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99586"
FT                   /db_xref="GOA:D6ZXE0"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXE0"
FT                   /protein_id="ADG99586.1"
FT                   /translation="MMWMICLFGGLGAMARYVLDVSIQQGWNRENRRTNRNFPLSTLVI
FT                   NGVASLCAGIAMMSYYSQSVDMDTVMMFVVGFLGGFSTFSTALNEVVSLIRQRRFTLAL
FT                   GYGIATVAVPLICVAAGFGIALLANPA"
     atgatgtgga tgatctgtct gttcggcggt ctgggcgcca tggcccgtta cgtgctcgac        60
     gtgtcaattc aacaaggctg gaaccgcgag aatcgaagaa cgaaccgcaa cttcccgcta       120
     tccacgctcg tcatcaacgg cgtcgcctcg ctatgcgcgg gcatcgccat gatgtcctac       180
     tattcgcaat cggtggatat ggacacggtc atgatgttcg ttgtcggatt tctcggtggt       240
     ttctcaacat tctccacggc gctcaacgaa gtggtttcat tgattcgcca gcgtcgtttt       300
     acgctggctc tgggctatgg aatagcaacc gtcgcggtgc ctctcatttg tgtggccgcc       360
     ggtttcggca ttgcgctgct tgccaatccg gcgtaa                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page