(data stored in ACNUC30630 zone)

EMBL: CP002010.RPSL

CP002010.RPSL        Location/Qualifiers
FT   CDS_pept        740171..740542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="BLJ_0592"
FT                   /product="ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00067"
FT                   /db_xref="GOA:D6ZT61"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT61"
FT                   /protein_id="ADH00067.1"
FT                   /translation="MPTIEQLVRKGRQAKPKKSKTLALKGSPLRRGVCTRVYTTTPKKP
FT                   NSALRKVARVRLSSGIEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDT
FT                   QGVKDRKQGRSLYGAKKAK"
     ttgcctacta ttgaacagct cgtccgtaag ggacgtcagg caaagccgaa gaagtccaag        60
     actttggccc tgaagggcag cccgctgcgt cgcggcgtgt gcacccgtgt ctacaccacc       120
     accccgaaga agccgaactc ggctctgcgt aaggtcgctc gtgtgcgcct gtcctcgggc       180
     atcgaagtca ccgcctacat tccgggcgaa ggccacaatc tgcaggagca ctccatcgtg       240
     ctcgtgcgcg gcggccgtgt gaaggatctc ccgggtgtgc gttaccacat cgtgcgtggc       300
     gcgctcgata cccagggtgt caaggaccgt aagcagggtc gttccctgta tggagcaaag       360
     aaggcgaagt aa                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page