(data stored in ACNUC1104 zone)

EMBL: CP002026.PE1

CP002026.PE1         Location/Qualifiers
FT   CDS_pept        169..450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0001"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   bvi:Bcep1808_0172 helix-turn-helix domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87338"
FT                   /db_xref="GOA:D6ZZS4"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZS4"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADH87338.1"
FT                   /translation="MCWATLGAGVRVTRETRGHGVREAAAAAGVSAATVSRCENGRELS
FT                   FDSLARLSAYVGLHPHAYTVKPFPDPGSTGNTHCNSLKTQEAPHDRHG"
     gtgtgctggg cgacgctcgg cgccggggtg cgggtgacgc gggagacgcg cgggcacggc        60
     gtgcgcgagg cggccgcggc ggccggggtt tccgccgcca cggtctcgcg ctgcgagaat       120
     gggcgcgagc tttccttcga cagccttgcg cggctctcgg cctatgtcgg cctgcacccg       180
     catgcctaca cggtgaagcc gtttcctgat cccggttcca cgggaaacac ccactgtaac       240
     agcttgaaaa cacaggaggc gccccatgat cgacatgggt ga                          282
//

If you have problems or comments...

PBIL Back to PBIL home page