(data stored in ACNUC1104 zone)

EMBL: CP002026.PE10

CP002026.PE10        Location/Qualifiers
FT   CDS_pept        6984..7343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0010"
FT                   /product="HNH endonuclease"
FT                   /note="KEGG: rsq:Rsph17025_1748 HNH endonuclease; PFAM: HNH
FT                   endonuclease; SMART: HNH nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87347"
FT                   /db_xref="GOA:D6ZZT3"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZT3"
FT                   /inference="protein motif:PFAM:PF01844"
FT                   /protein_id="ADH87347.1"
FT                   /translation="MARLTTLPPRLSALPPRLAVQTHTGPDRDRVRMAGAPWRAWYKTA
FT                   RWRALRLRVFTRDLFACQMKDCGRVEADTSLLVCDHIHPHRGDEHLFWDEGNLQTLCKP
FT                   CHDSVKQAEERRGGW"
     atggcgcgac tgaccacgtt gccgccccgc ctttcggctc ttccgcctcg cctcgcagta        60
     cagacgcaca ccggccctga tcgtgatcgg gtgcgcatgg cgggtgcgcc gtggcgagcc       120
     tggtacaaga cggctcggtg gcgggcactt cggctccgcg tgttcacgcg cgacctgttc       180
     gcctgccaga tgaaggactg cggtcgcgtc gaggcggaca cctcccttct ggtctgcgac       240
     cacatacatc cgcaccgggg cgatgagcac ctgttctggg acgagggcaa cctgcagacc       300
     ctctgcaagc cgtgccacga cagcgtgaag caggccgagg aacggcgcgg cggctggtga       360
//

If you have problems or comments...

PBIL Back to PBIL home page