(data stored in ACNUC1104 zone)

EMBL: CP002026.PE100

CP002026.PE100       Location/Qualifiers
FT   CDS_pept        91184..92413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0100"
FT                   /product="protein of unknown function DUF1688"
FT                   /note="PFAM: protein of unknown function DUF1688; KEGG:
FT                   bja:blr7238 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87437"
FT                   /db_xref="InterPro:IPR012469"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0S7"
FT                   /inference="protein motif:PFAM:PF07958"
FT                   /protein_id="ADH87437.1"
FT                   /translation="MTPPELVALRSPAAVRARCHQVLDYVRVGHSPHFTVDEAALDGVA
FT                   DYVAQVTRQAYPTLDIPYHSRWRHFDAGGVDRWAALEGRLEGADKAERARVMIDLAVVS
FT                   VLLDAGAGDAWRYREEATGLTVTRSEGLAVASLRMFEVGGFSSDPKVPLRADAKALIGL
FT                   DAATLAKQFQVSDDNPLVGVSGRVALINRLGNALAARPDLFGTEVPRPGGLYDALLPKA
FT                   KIGRLPAPAILGALLDGLSSIWPSGLDVEGVALGDVGRHPAVRVADLSDQLVPFHKLSQ
FT                   WLTYSLLEPFEAAGLAVTELDELTALPEYRNGGLLVDLEVIVPRQPIDPAQKHPVSSEL
FT                   VVEWRALTVALMDLLAGRVRERLGLDASQFPLAKLLQGGTWSAGRRIAAERRPPAGPPP
FT                   IAIDADGTVF"
     atgaccccgc ccgaactcgt cgccctgcgc tcgcccgccg cggtgcgcgc ccgctgccat        60
     caggtgctcg actatgtgcg ggtcgggcat tcgccgcatt tcaccgtcga cgaggcggcg       120
     ctggacgggg tggcagacta tgtcgcgcag gtgacgcggc aggcctatcc gaccctcgac       180
     atcccctatc acagccgctg gcggcacttc gacgcgggcg gggtcgaccg ctgggccgcg       240
     ctggaaggta ggctcgaagg cgcggataag gccgaacgcg cccgcgtcat gatcgacctc       300
     gccgtggtga gcgtgctgct cgatgccggc gccggcgacg cctggcgcta ccgcgaagaa       360
     gcgacgggct tgaccgtcac ccgctcggaa ggcctcgccg tggcgagcct gcgcatgttc       420
     gaggtgggcg gtttttcctc cgaccccaag gtgccgctgc gcgccgatgc aaaagcgctg       480
     atcggcctcg atgcggcgac gctggcgaag caattccagg tgtcggacga caatccgctg       540
     gtcggcgtgt ccggccgggt ggcgctcatc aaccggctcg gcaacgcgct cgcggcgcgg       600
     ccggacctgt tcggcaccga ggtgccacgg ccgggcgggc tttatgatgc gctgctgccc       660
     aaggcgaaga tcggccggct gccggcgccc gctatactcg gcgcgttgct cgacgggctg       720
     tcctccatct ggccctctgg cctcgatgtc gagggcgtcg cgctgggcga tgtcggccgc       780
     catccggcgg tgcgggtcgc cgacctctcc gaccagctcg tgccgtttca caagctgtcg       840
     caatggctga cctattcgct gctggagccc ttcgaggcgg cgggcctcgc cgtcaccgag       900
     ctcgatgagc tgaccgcgct gcccgagtac cgcaatggcg ggctgctggt ggatctggag       960
     gtgatcgtgc cgcgccagcc catcgatccg gcgcagaagc acccggtgtc gtccgagctg      1020
     gtggtagaat ggcgcgcgct caccgtggcg cttatggacc tgctggccgg ccgcgtgcgc      1080
     gagcggctcg gcctcgacgc ctcgcagttc ccgctcgcca agctgttgca gggcggcacc      1140
     tggagtgccg ggcgccgcat cgccgccgag cgccgcccgc ccgccggccc gccgccgatc      1200
     gccatcgacg cggacgggac ggtgttctga                                       1230
//

If you have problems or comments...

PBIL Back to PBIL home page