(data stored in ACNUC1104 zone)

EMBL: CP002026.PE101

CP002026.PE101       Location/Qualifiers
FT   CDS_pept        complement(92417..93379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0101"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ret:RHE_CH03508 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87438"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0S8"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ADH87438.1"
FT                   /translation="MHRVLFAAAAAVLLSLSSAGAQDFPNRPVTLDIPFPAGGSTDLVG
FT                   RLIGEGMSADLGQPVIIENRGGGGGSLGTAHLAKQPPDGYAVMMGTVSTHALNPALYRN
FT                   LPFDPVKSFAPVSLLVIVPNALVVHPSFPANTVEEFIALLKANPGKYSYASAGNGTPGH
FT                   LSGELFKTMAGVDMQHIPYQGAGPALVDVISGQVPIMFDNLPTASGYIKSGKLKTLGVT
FT                   TLKRAPSFPDLPAVAETLPGYETYSWNALFAPAGTPPAIVAKLNQAANKALATPKVQAR
FT                   LADFSAVSVGSTPQELEAHVKAELAKWAPIVKASGAQLD"
     atgcatcgtg tcttattcgc cgcggccgcc gccgtgcttc tctcgctgtc atccgctggc        60
     gctcaggatt ttccgaatcg gccggtcacg ctcgacatac ccttccccgc cggcggatcg       120
     actgacctcg tgggtcggct gatcggcgag ggcatgagcg ccgacctcgg ccagcccgtc       180
     atcatcgaga atcgcggcgg tgggggcggg agcctcggaa ccgcccatct cgccaagcag       240
     ccgccggacg gctacgcggt gatgatgggc acggtctcga cccacgcgct caacccggcg       300
     ctctaccgca acctgccctt cgacccggtg aagagcttcg cgcccgtgtc gctgctcgtc       360
     atcgtgccga acgcgctggt cgtccatccg agcttcccgg cgaacacggt cgaggagttc       420
     atcgccctgc tcaaggccaa tcccggcaag tattcctacg cctccgccgg caacggcacg       480
     ccggggcacc tgtcgggcga gctgttcaag accatggccg gcgtcgacat gcagcacatc       540
     ccctatcagg gggcggggcc ggcgctggtc gacgtcatct ccgggcaggt gccgattatg       600
     ttcgacaatc tgccaaccgc ctccggttac ataaagagcg gcaagctcaa gacgctcggc       660
     gtgacgacgc tgaagcgcgc gccgtccttc cccgacctgc cggcggtcgc ggagacgctg       720
     ccgggctacg agacctatag ctggaacgcg ctgttcgccc cggccggcac gccacccgcc       780
     atcgtggcga aactgaacca ggccgccaac aaggcgctgg cgacgcccaa ggtgcaggcg       840
     cgcctcgccg atttcagcgc cgtctcggtc ggctcgacgc cgcaggagct ggaggcccat       900
     gtgaaggccg agctcgccaa atgggcccca atcgtaaagg cgtcgggcgc gcagctggat       960
     tga                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page