(data stored in ACNUC1104 zone)

EMBL: CP002026.PE104

CP002026.PE104       Location/Qualifiers
FT   CDS_pept        96119..97426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0104"
FT                   /product="ABC transporter, binding protein"
FT                   /note="KEGG: rhi:NGR_b12830 ABC transporter, binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87441"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0T1"
FT                   /inference="similar to AA sequence:KEGG:NGR_b12830"
FT                   /protein_id="ADH87441.1"
FT                   /translation="MSKNTSDRIGASGAKGISRRNVLKGAAAFSGVAAGSGAITGFPTI
FT                   WAQNPITLRQFGTGVSNLNAIAEKCKADLGITLQMTALDSDAVSQRVVTQANSFDIADI
FT                   EYWICKKVFAAGTLQPMDVKKIKYYDQIVPIFTTGKLTPESKIAQGTAPSTVGFVEGPD
FT                   SKKFAKEPTQWMTLIPTIYNADTLGIRPDLVGRPIKNWKDILDPAFKGKTSILNIPSIG
FT                   IMDAAMICESAGLIKYADKGNMTKKEIDFTIDFLIKTKKAGQFRAFWKTFDESVNLMAS
FT                   GEVVIQSMWSPAVAAVRSKGIPCVYQPLEEGYRAWGGGLGMAKHLKGAQLDAAYEYINW
FT                   YLSGWVGAYLNRQGYYSAVLSTAEKNMTPDEWAFWMLGQPAKADILSPEGKVMYTAGAV
FT                   RDGGSFEQRMGAVACWNSVMDEDRYMVRRWNEFIAA"
     atgagcaaga acacttcgga tcgcatcggc gccagcggcg ccaagggcat tagccgtcgc        60
     aacgtcctca agggcgccgc ggccttcagt ggcgtcgccg cgggctcggg agcgatcacc       120
     ggcttcccca ccatctgggc tcagaacccg atcacgctgc gccagttcgg caccggcgtg       180
     tcgaacctca acgccatcgc cgagaagtgc aaggccgacc tcggcatcac cctgcagatg       240
     acggcactgg attccgacgc cgtctcccag cgcgtcgtca cgcaagccaa cagcttcgac       300
     atcgccgaca tcgaatactg gatctgcaag aaagtgttcg ccgccggcac gctgcagccg       360
     atggacgtga agaagatcaa gtattacgac cagatcgtgc cgatcttcac caccggcaag       420
     ctgaccccgg aatcgaagat cgcgcagggc accgcgccga gcacggtcgg cttcgtcgaa       480
     gggccggatt ccaagaagtt cgccaaggag ccgacccagt ggatgacgct catcccgacc       540
     atctataacg ccgacacgct gggcatccgc cccgacctcg tcggccggcc gatcaagaac       600
     tggaaggaca tcctcgaccc ggccttcaag ggcaagacct ccatcctgaa catcccgtcc       660
     atcggcatca tggacgcggc gatgatctgc gagagcgccg ggctgatcaa atatgccgac       720
     aagggcaaca tgacgaagaa ggagatcgat ttcaccatcg acttcctgat caagaccaag       780
     aaagccggcc agttccgagc cttctggaag acattcgacg agagcgtcaa cctcatggcc       840
     tcgggcgagg tggtgatcca gtccatgtgg tcgccggcgg tggcggcggt gcgctcgaag       900
     ggcatcccct gcgtctacca gccgctggaa gagggctacc gcgcctgggg cggcggcctc       960
     ggcatggcca agcacctgaa gggcgcgcag ctcgacgcgg cctatgagta catcaactgg      1020
     tacctgtcgg gctgggtcgg cgcctatctc aaccgccagg gctattactc ggccgttctt      1080
     tccaccgccg agaagaacat gacgccggac gaatgggcgt tctggatgct cgggcagccc      1140
     gccaaggccg acatcctctc gccggaaggc aaggtgatgt acacggccgg cgcggtgcgc      1200
     gacggcggct ccttcgagca gcgcatgggc gcggtcgcct gctggaactc ggtgatggac      1260
     gaggaccgct acatggtccg ccgctggaac gagttcatcg cggcgtga                   1308
//

If you have problems or comments...

PBIL Back to PBIL home page