(data stored in ACNUC1104 zone)

EMBL: CP002026.PE106

CP002026.PE106       Location/Qualifiers
FT   CDS_pept        98435..99265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0106"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: atc:AGR_L_3448 hypothetical
FT                   ABC transporter permease protein YdcV"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87443"
FT                   /db_xref="GOA:D7A0T3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0T3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH87443.1"
FT                   /translation="MNSEKRGPGFYVLTAFFVLFVLFLYGPLTTIFILSFQGPNGGLTF
FT                   PMNGVSLRWFNNLLFEQQAVGDFGGAFTRSLVLGIMTMLTTVVVSLLAGLAFRRRFLGS
FT                   GPLFYLTIASLIVPSILISLGIGLAFNVLGLETAWYSSAFGAHLTWTLPFGLLIMFAVF
FT                   NRFNPAYEEAARDLGASPWQTFAHVVLPIILPSLIGVGLFGFTLSYDEFARTLMTSGTF
FT                   NTLPLEIYGMTTNVTTPVLYALGTVTTVFSMGVIILALVTIAVLRKRRARRVAG"
     atgaattcgg aaaagcgcgg ccccggcttc tatgtgctca ccgccttctt cgtgctgttc        60
     gtgctattcc tctacgggcc gctgacgacg atcttcatcc tgtccttcca ggggccgaat       120
     ggcgggctca ccttcccgat gaacggggtg tcgctgcgct ggttcaacaa tctcctgttc       180
     gagcagcagg cggtgggcga tttcggcggc gccttcaccc gctcgctcgt gctcggcatc       240
     atgaccatgc tcaccaccgt ggtggtgtcg ctgctggcgg gcctcgcctt ccggcgccgc       300
     ttcctcgggt cggggccgct gttttacctg accatcgcca gcctgatcgt gccctcgatc       360
     ctgatctcgc tcggcatcgg ccttgccttc aacgtgttag ggctggagac ggcctggtac       420
     tcctcggcct tcggcgcgca tctcacctgg acgctgccct tcggcctctt gatcatgttc       480
     gccgtgttca accgcttcaa cccggcctat gaggaggccg cgcgcgacct cggcgcgagc       540
     ccgtggcaga ccttcgccca tgtggtactg ccgatcatcc tgccgagcct gatcggcgtc       600
     ggcctgttcg gcttcacgct gtcctatgac gagttcgccc gcacgctgat gacctcgggc       660
     accttcaaca cgctgccgct ggagatctac ggcatgacca ccaacgtcac cacgccggtg       720
     ctctatgcgc tgggcacggt gacgacggtg ttttccatgg gcgtgatcat cctcgcgctg       780
     gtgaccatcg cggtgctgcg caagcggcgg gcacggcgcg ttgccggctg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page