(data stored in ACNUC1104 zone)

EMBL: CP002026.PE11

CP002026.PE11        Location/Qualifiers
FT   CDS_pept        7443..7940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0011"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsq:Rsph17025_1749 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87348"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZT4"
FT                   /inference="similar to AA sequence:KEGG:Rsph17025_1749"
FT                   /protein_id="ADH87348.1"
FT                   /translation="MSDEKSEAPGEVDLFGMPVRPIRDRRGRPCFKKDKENQDFVAVRI
FT                   AAGWSQARIAEDMGIDEKTLRKHFSRELENGRVFVEGLVLDVLLKQTREGKSPAIRQLR
FT                   EMLEAAGPQAPRGRSKPKSDEEEEDEDGKAAPVGKKEQQMQDAQVVPPEYGDIFDRIDR
FT                   RH"
     gtgagcgatg aaaaatccga agcgccgggc gaagtcgacc tgttcggcat gcctgtgcgg        60
     ccgatccgtg atcggcgcgg gcgcccctgc ttcaagaaag acaaggaaaa ccaagacttt       120
     gtcgcggtac ggatcgcggc cggctggtcg caggcgcgca tcgccgagga tatgggcatc       180
     gacgagaaga cgctgcggaa acatttttcc cgcgaactgg agaatggccg cgtcttcgtc       240
     gagggcctgg tgctcgacgt gctgctgaag cagacccgcg aagggaagtc gcccgcgatc       300
     cgccagctgc gcgagatgct ggaagcggcc gggccgcagg cgcctcgcgg ccggtccaag       360
     ccgaagtccg acgaggagga ggaggacgaa gacggcaagg ccgcgccggt cggcaagaaa       420
     gagcagcaga tgcaggatgc gcaggtggtg ccgcctgagt atggcgacat cttcgaccgg       480
     atcgaccggc gccactga                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page