(data stored in ACNUC1104 zone)

EMBL: CP002026.PE110

CP002026.PE110       Location/Qualifiers
FT   CDS_pept        101478..104981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0110"
FT                   /product="outer membrane autotransporter barrel domain
FT                   protein"
FT                   /note="KEGG: rlg:Rleg_0480 outer membrane autotransporter
FT                   barrel domain protein; TIGRFAM: outer membrane
FT                   autotransporter barrel domain protein; PFAM:
FT                   Autotransporter beta- domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87447"
FT                   /db_xref="GOA:D7A0T7"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR030895"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0T7"
FT                   /inference="protein motif:TFAM:TIGR01414"
FT                   /protein_id="ADH87447.1"
FT                   /translation="MTRVKLGISSGRAAEAGNGRSGRTRHAALLATTAVIALAYASPVS
FT                   AQTLWTGTNSNNWFDPGNWSAGLPNNVTDAEVDNIAVNAPAVFAIGANARDLTIGNSAV
FT                   GSLTVQGAGVLLTTNGYIGRGLGSTGTVVVTGTDSVWANTGDFYVGDQGSGSLTIANGG
FT                   QVISNDSFVGNVGSGLVTVTGTDSTWTVTDPLIVGNFGSGMVNVDTGGTVETERVTVGA
FT                   ANGSEGFLDISGGTTSWIASSEFIVGEEGSGTVTVSDGATVESQTLAVGFGPTGFGQVT
FT                   ITGVGTTWTTTASTGIGSDGVGHLLIEAGAAFNTVGVSLGTGSGTVTGAGSSLTASGQI
FT                   FVGAGGESTFTVSDGASVTSVGANIALGGTGTATVTSGANWTSSSTFIVGHSGLGTLNV
FT                   TDGGTVNTLDSVLGRFAAGVGILNVEGEGASFVNTGNMGIGNEGTGALSVTAGGTAEAQ
FT                   SVLLGMEANSGGSASISGAGSSLTSNEFLFVGLEGNGVMFVEDGAQVNSVVAGIGASTG
FT                   GIGEATVSGATWLNSSDLFIGADGTGVLTIADGGRVEVGGAVEIAAGAGSSGTLNIGAG
FT                   EGLAAAAPGTLAAGEIVFGPGTGAIVFNHTSTNYQFSAGMTGTGTIDLFSGTTVLTGNS
FT                   SGFTGATTLHGGTLAVNGTLGGTLDVLAGRLQGTGTVGSTTIAGGAVIAPGNSIGTLNI
FT                   AGNATFAAGSAYELELDPNSSNGDLIHATGTVAIEGGTVEHIGLAGAYSPLRTYTIVTA
FT                   DGGVDGEFAAVTSDFAFLDPTLSYDPNNVYLTLIRNDVDFGAVGLTPNQIATGNGTESL
FT                   GLGNPLYDAVLGLSAAQARGAFDLLSGEIHASAKSVLIDDSRFVREAAIDRVRAALGGV
FT                   GASVSPVMAYGEGGPQSAAPTTDRFAIWGQGFGSWGQIDGDGNAAQINSSTGGFFLGAD
FT                   APIFETWRLGVIAGYSRTNFDVDARASSGSSDNYPLGIYTGTQWGNLGFRSGLAYTWHE
FT                   IDTSRSVAFPGFSESLTSSYDASTFQAFGELGYRIDVQAVAFEPFANVAYVSFDSDGFT
FT                   EQWGAAALYAGGQTTDTTFTTLGLRVAAGLGLAGADVTLRGTLGWRHAFGDVTPLSTQA
FT                   FAGGDPFTIAGVPIAENAAVVEAGLDWNLTPQATLGVAYNGQLASDAQQNGFTARLTVE
FT                   F"
     atgacgcggg tgaagctggg tatatcgagc ggtcgggccg cggaggcggg taacgggcgc        60
     tcagggcgca cgcgtcatgc ggcgctgctg gcgaccaccg ccgtcatcgc gctcgcctat       120
     gcgtcgccgg tgagcgcgca gacgctctgg accggcacca attcgaacaa ctggttcgat       180
     cccggcaact ggagcgccgg cctgcccaac aacgtcaccg acgccgaggt cgacaacatc       240
     gcggtgaacg cgccggcggt gtttgccatc ggcgccaatg cgcgcgatct caccatcggc       300
     aacagcgcgg tcggctcgct gacggtgcag ggtgccggtg tgctgctgac caccaacggc       360
     tatatcggcc ggggcctcgg ctccaccggc acggtggtcg tcaccggcac cgattccgtc       420
     tgggcgaaca ccggcgattt ctatgtcggc gaccagggca gcggcagcct gaccatcgcc       480
     aatggcggcc aggtcatcag caacgattcc ttcgtcggca atgtcggctc gggcctggtg       540
     acggtcaccg gcacggattc cacctggacg gtcaccgatc cgctgatcgt cggcaatttc       600
     ggcagcggca tggtcaatgt cgacaccggc gggaccgtgg agaccgagcg ggtgactgtc       660
     ggcgccgcca acgggtccga aggcttcctc gacatcagcg gcggcacgac gagctggatc       720
     gcctccagcg aattcatcgt cggtgaggaa ggcagcggta cggtcacggt ctccgatggc       780
     gccacggtgg aatcgcagac gctcgctgtc ggcttcggcc ctaccggctt cgggcaggtg       840
     accatcaccg gggtgggcac cacgtggacg acaaccgcct cgaccggcat cggcagcgat       900
     ggcgtcggcc atctgctcat cgaggccggc gcggcattca ataccgtcgg cgtatccctc       960
     ggcaccggtt cgggcacggt caccggcgcg ggttcgagcc tcacggcaag cggacagatc      1020
     ttcgtcggtg ccggcggcga gagcacgttc accgtatccg acggtgcgag cgtgacgagc      1080
     gtcggcgcga acatcgcgct cggcggcacc ggcaccgcga ccgtcaccag cggcgccaac      1140
     tggacgagca gctcgacctt catcgtcggg cactccggtc tcggcacgct caatgtcacc      1200
     gatggcggca cggtgaacac gctggattcc gtcctcggcc gctttgccgc cggcgtcggc      1260
     atcctgaacg tcgagggcga gggggcgagc ttcgtcaaca ccgggaacat gggcatcggc      1320
     aacgagggca ccggtgcgct gtcggtcacg gccggcggca cggcggaggc gcagagcgtc      1380
     cttctcggca tggaagcgaa ctcgggtggc agcgcatcca tcagcggcgc cggctcgtcg      1440
     ctcaccagca acgaattcct cttcgtcggc ctcgaaggca atggcgtgat gttcgtcgag      1500
     gacggcgcgc aggtaaattc ggtggtggcg ggcatcggcg cttcgaccgg cggcatcggc      1560
     gaggcgacgg tctccggcgc gacctggctg aacagcagcg atctcttcat cggcgccgac      1620
     ggcaccggcg tgctgaccat cgccgatggc ggccgagtcg aggtcggcgg tgcggtggag      1680
     atcgccgcgg gcgcgggctc ctccggcacg ctgaacatcg gcgccggcga ggggcttgcg      1740
     gctgctgccc cgggcacgct cgcggcgggc gagatcgtct tcgggccggg caccggcgcc      1800
     atcgtcttca accacacctc gacgaactac cagttctccg ccggcatgac cggcaccggc      1860
     accatcgacc tgttctccgg caccacggtg ctgaccggca attcgagcgg ctttaccggc      1920
     gcgacgacgc tccatggcgg cacgctggcg gtgaacggca cgctcggcgg cacgctggac      1980
     gtcctcgccg gccgcctaca gggcacgggc acggtcggct cgaccaccat cgccggcggc      2040
     gccgtcatcg cgcccggcaa ctccatcggt acgctgaaca tcgccggcaa cgcgactttc      2100
     gcagccggca gcgcttacga gcttgaactc gaccccaaca gcagcaatgg cgacctaatc      2160
     catgccaccg gcaccgtcgc catcgagggc ggcacggtgg agcatatcgg ccttgccggc      2220
     gcctacagcc ccctgcgcac ctataccatc gtcaccgccg acggcggcgt ggacggcgag      2280
     ttcgcggcgg tgacgtccga tttcgccttc ctcgacccga cgctgagcta cgacccgaac      2340
     aacgtctatc tcacgctcat ccgcaacgac gtcgatttcg gcgcggtcgg cctgaccccg      2400
     aaccagatcg ccaccggcaa tggcacggaa agcctcggtc tcggcaatcc gctctatgac      2460
     gcggtgctcg gcctgtcggc cgcgcaggcg cgcggtgcct tcgacttgct atcgggcgag      2520
     atccacgcct cggccaagag cgtgctgatc gacgacagcc gcttcgtccg cgaggcggcg      2580
     atcgaccgcg tgcgtgcggc gctgggaggc gtcggcgcct cggtctcgcc ggtgatggcc      2640
     tatggcgagg gcgggccgca atccgccgct ccgaccaccg accgcttcgc catctggggg      2700
     cagggcttcg gctcctgggg ccagatcgac ggcgacggca acgcggcgca gatcaatagc      2760
     tcgaccgggg gcttctttct cggcgccgac gcgccgatct tcgagacttg gcggctcggc      2820
     gtcatcgccg gctacagccg gaccaatttc gacgtggacg cccgcgcctc ctcgggcagc      2880
     agcgacaatt acccgctcgg catctatacc ggcacgcagt ggggcaatct cggcttccgc      2940
     tccggcctcg cctatacgtg gcacgagatc gacaccagcc gctccgtcgc cttccccggc      3000
     ttcagcgaga gcctgacgag cagctacgat gcctcgacct tccaggcctt cggcgagctc      3060
     ggctaccgca tcgatgtgca ggctgtggcg ttcgagccct tcgccaacgt cgcctatgtc      3120
     agcttcgaca gtgacggctt caccgagcaa tggggtgccg cggcgcttta tgccggcggg      3180
     cagaccaccg acaccacttt caccaccctc ggcctgcgcg tcgcggccgg gctcggcctc      3240
     gccggcgccg acgtcacgct gcgcggcacg ctcggctggc gccacgcctt cggcgacgtg      3300
     acgccgctct cgacgcaggc tttcgccggc ggcgatccct tcaccatcgc cggcgtgccg      3360
     atcgcggaga atgccgccgt cgtcgaggcg ggactcgact ggaacctgac gccgcaggcg      3420
     acgctgggcg tcgcctataa cggccaactc gcctccgacg cgcagcagaa cggcttcacc      3480
     gcgcggctga cggtcgagtt ctga                                             3504
//

If you have problems or comments...

PBIL Back to PBIL home page