(data stored in ACNUC1104 zone)

EMBL: CP002026.PE112

CP002026.PE112       Location/Qualifiers
FT   CDS_pept        complement(106198..107730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0112"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bid:Bind_3073 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87449"
FT                   /db_xref="GOA:D7A0T9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0T9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87449.1"
FT                   /translation="MSALLEMRGISKHFTGVKALNDVSFEVEPGEIHALVGENGAGKST
FT                   LMKVLSGVYPHGSYDGSIMFDGEERRFRDIIDSEALGIIIIHQELALIPLMSIAENIFI
FT                   ANPPARFGVIDRGAVHRRTRELLAKVGLNEEPDTLVTDIGVGKQQLVEIAKALSKKVRL
FT                   LILDEPTASLSEKDSAALLDLLREFRAQGISSILISHKLNEVSKVADRITVLRDGRTVD
FT                   TMDCHEGAVEEDRIIRKMVDRDLEHRFPKREPKIGETIFRVADWSVHHPLHADRQVIKD
FT                   VDFEVRRGEIVGIAGLMGAGRTEFAMSIFGRSWGQKIGGRAEIEGREADLSTVRRAIDA
FT                   GLAYVTEDRKELGLLLNEDVRKNVTLANLAAVSSAQVIDDVRELAVASDYRGRMRIRSH
FT                   SVYQEAGKLSGGNQQKVVLSKWLFTDPKVLILDEPTRGIDVGAKYEIYCIINELADAGK
FT                   GVVVISSEMPELLGICDRICVMNEGAFVGEFPAAEATQEKIMRAIMRKGDRS"
     atgagcgcac ttctggagat gcggggcatc agcaagcact tcaccggcgt gaaggcgctg        60
     aacgatgtct cgttcgaggt cgagccgggc gagatccacg ccctcgtcgg cgagaacggc       120
     gcgggcaagt cgacgctgat gaaggtcctg agcggggtct acccgcacgg ctcctatgac       180
     ggctcgatca tgttcgacgg cgaggagcgg cgcttccgcg acatcatcga ttccgaggcg       240
     ctcggcatca tcatcatcca tcaggaactg gcgctgatcc cgctgatgtc gatcgcggag       300
     aacatcttca tcgccaatcc gccggcgcgc tttggcgtca tcgaccgcgg cgccgtgcac       360
     cggcgcaccc gcgaattgct cgccaaggtc ggcctcaacg aggagccgga tacactcgtc       420
     accgacatcg gcgtcggcaa gcagcagctc gtcgagatcg ccaaggcgct gtcgaagaag       480
     gtgcgcctgc tcatcctcga cgagccgacc gccagcctct cggagaagga cagtgcggcg       540
     ctgctcgacc tgctgcgcga attccgcgcg cagggcatct cctctatcct catctcgcat       600
     aagctgaacg aggtctcgaa ggtcgccgac cgcatcaccg tgctgcgcga cgggcgcacc       660
     gtcgacacca tggactgcca cgagggcgcg gtggaggaag accgcatcat ccgcaagatg       720
     gtcgaccgcg acctcgagca ccgcttcccc aagcgcgagc cgaagatcgg cgagacgatc       780
     ttccgggtag ccgactggtc ggtccaccac cccctccatg ccgaccggca ggtgatcaag       840
     gacgtcgact tcgaggtccg acgcggcgag atcgtcggca tcgcagggct gatgggcgcc       900
     gggcgcaccg agttcgccat gagcatcttc ggccgctcct ggggccagaa gatcggcggc       960
     cgcgccgaga tcgaggggcg ggaggcggac ctatcgaccg tgcgccgggc catcgacgcc      1020
     ggcctcgcct atgtcaccga ggaccgcaag gaactcggcc tgctgctgaa cgaggacgtg      1080
     cgcaagaacg tcacgctggc gaacctcgcc gcggtttctt ccgcgcaggt gatcgacgac      1140
     gtgagggagc tcgccgtcgc ctccgactat cgcggccgca tgcgcatccg cagccacagt      1200
     gtctaccagg aggccggcaa gctctccggc ggcaaccagc agaaggtggt gctgtcgaaa      1260
     tggctgttca ccgaccccaa ggtgctgatc ctcgacgagc ccacgcgcgg catcgacgtc      1320
     ggcgccaagt acgaaatcta ctgcatcatc aacgagctcg cggatgccgg caaaggcgtg      1380
     gtggtcatct cctccgagat gccggaactg ctcggcatct gcgaccgcat ctgcgtgatg      1440
     aatgagggcg ccttcgtcgg cgagttcccc gccgccgagg cgacacagga aaagatcatg      1500
     cgcgccatca tgcgcaaggg agaccgctca tga                                   1533
//

If you have problems or comments...

PBIL Back to PBIL home page