(data stored in ACNUC1104 zone)

EMBL: CP002026.PE114

CP002026.PE114       Location/Qualifiers
FT   CDS_pept        complement(108969..109898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0114"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: bid:Bind_3075 SMP-30/gluconolaconase/LRE
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87451"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0U1"
FT                   /inference="protein motif:PFAM:PF08450"
FT                   /protein_id="ADH87451.1"
FT                   /translation="MTITSAQAPATTEPTLETLPVAVLCEERCHLGEGPSYDAARDTAW
FT                   WFDILEKRLCEARLAGGAVTVHSLPFMASALAMVDDRRQLLLTENGLVLRDIAGGRLEP
FT                   VADIEAGNPATRSNDGRVHPSGTFWISTMGRHAEREAGTIYAYRDGAVAPLFPGITIPN
FT                   AICFSPDGTLGYFADTKANRLHRVRLDPATGLPLESPSVLRVHTGAGGFDGAVTDAEDL
FT                   VWCAIWGGGRLEAYTPAGDLVRSVAVPARQTSCPVFVGPAFDRVLVTSAFENMDEAARA
FT                   ADPHHGKTFLLDIGVRGHAEPRVRLGGA"
     gtgacaatca ctagcgcgca ggcgcctgcc accacggagc cgacgctgga gacactgccg        60
     gtcgcggtac tgtgcgagga gcgctgccat ctcggcgagg ggccgagcta cgatgcggcg       120
     cgcgacaccg cctggtggtt cgacatcctc gaaaagcggc tctgcgaggc ccggctcgcc       180
     gggggggccg tcaccgtcca ttcgctgccc ttcatggcga gcgcgctggc catggtcgac       240
     gaccgccgcc agctgctgct gacggagaac gggctggtgc tgcgcgacat cgccggcggc       300
     cggctggagc ctgtcgcgga catcgaggcc ggcaacccgg ccacccgctc gaatgacggg       360
     cgcgtgcatc cgagcggcac cttctggatc agcaccatgg gccgccatgc cgagcgggag       420
     gccgggacga tctacgccta tcgcgacggc gcggtggcgc ctctcttccc cggcatcact       480
     atcccaaacg ccatctgctt ctcgccggac ggcacgctcg gctacttcgc cgatacgaag       540
     gcgaaccggc ttcaccgggt gcggctcgac ccagctaccg gcctgccgct ggagagccca       600
     tccgtgctgc gcgtccacac cggcgccggc gggttcgacg gcgcggtgac ggatgccgag       660
     gacctcgtct ggtgcgccat ctggggcggc ggccggctgg aggcctatac gccggcggga       720
     gacctcgtcc gcagcgtcgc cgtccccgcg cggcagacga gttgcccggt tttcgtcggc       780
     ccggccttcg accgcgtgct ggtcacctcc gccttcgaga acatggacga ggcggcccgc       840
     gccgccgacc cccatcacgg caagaccttc ctcctcgaca tcggcgtgcg cggacacgcc       900
     gagccgcgcg tgcggctagg aggcgcctga                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page