(data stored in ACNUC1104 zone)

EMBL: CP002026.PE115

CP002026.PE115       Location/Qualifiers
FT   CDS_pept        complement(109885..111690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0115"
FT                   /product="Dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="KEGG: atc:AGR_L_3190 putative dihydroxy-acid
FT                   dehydratase; PFAM: dihydroxy-acid and 6-phosphogluconate
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87452"
FT                   /db_xref="GOA:D7A0U2"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0U2"
FT                   /inference="protein motif:PRIAM:4.2.1.9"
FT                   /protein_id="ADH87452.1"
FT                   /translation="MHGKTQKTDRTLRSRAWFDNPANADMTALYLERYLNYGLSQEELQ
FT                   SGRPIIGIAQTGSDLSPCNRHHLELAKRVREGIREAGGIAIEFPVHPIQETGKRPTAGL
FT                   DRNLAYLGLVEVLYGYPLDGVVLTIGCDKTTPACLMAAATVNIPAIALSVGPMLNGWYK
FT                   GERTGSGTIVWKARELLATGEIDYQGFVKLVASSAPSTGYCNTMGTATTMNSLAEALGM
FT                   QLPGAAAIPAPYRDRQEAAYRTGLRIVEMVHEDLKPSDILTREAFLNAIRVCSAIGGST
FT                   NAPVHLNALARHVGVELSIDDWQAHGEDVPLLVNLQPAGAYLGEDYYRAGGVPAVVNQL
FT                   MAQGLVHEDAVTANGRSIGENCRDSAIADEDVIRPYDRPLKEKAGFRVLRGNLFSSAIM
FT                   KMSVISPEFRARYLSNPDDPEAFEGRAVVFDGPEDYHARIDDPALAVDEMTVLFMRGAG
FT                   PVGYPGAAEVVNMRAPDYLIKAGIHSLPCIGDGRQSGTSGSPSILNASPEAAAGGGLAV
FT                   LRTGDRVRIDLKRNSADMLVPEEELERRRQELVAQGGYHYPAHQTPWQEIQRGLVGQLE
FT                   TGAVLEPAVRYQRIAQTKGVPRDNH"
     atgcacggaa aaacacagaa aaccgaccgc acgctccgct cccgagcctg gttcgacaac        60
     ccggccaatg ccgacatgac agcgctctac ctggagcgct acctgaacta cggcctcagc       120
     caggaggagt tgcagagcgg gcggccgatc atcggcatcg cccagaccgg ctcggacctc       180
     tcgccctgca atcgccacca cctcgaactc gccaagcggg tgcgcgaggg catacgcgag       240
     gccggcggca tcgccatcga attcccggtc catcccatcc aggagaccgg caagcgcccc       300
     accgccgggc tcgaccgcaa cctcgcctat ctcggcctcg tcgaggtgct ctacggctat       360
     ccgctcgacg gggtggtgct gaccatcggt tgcgacaaga ccacgcccgc ctgcctgatg       420
     gcggcggcca ccgtgaacat cccggccatc gccctctcgg tcgggccgat gctgaacggc       480
     tggtacaagg gcgagcgcac cggctcgggc accatcgtgt ggaaggcgcg cgagctgctc       540
     gccaccggcg agatcgacta ccagggcttc gtgaagctcg tcgcctcctc cgctccctcc       600
     accggctact gcaacaccat gggtacggcg acgaccatga actcgctcgc cgaggcgctg       660
     ggcatgcagc ttcccggcgc ggcggccatc cccgcgccct atcgcgaccg gcaggaggcc       720
     gcctaccgca ccggcctgcg catcgtcgag atggtgcatg aagacctgaa gccttccgac       780
     atcctcaccc gcgaggcctt cctcaacgcc attcgggtct gctccgccat cggcggctcg       840
     accaatgcgc cggtgcacct gaacgcgctc gcccgccatg tcggcgtcga gctctcgatc       900
     gacgactggc aggcgcatgg cgaggacgtg ccgctgctgg tcaatctcca gccggccgga       960
     gcctatctcg gcgaggacta ttaccgcgcc ggcggcgtcc ccgccgtggt gaaccagctg      1020
     atggcgcagg gcctcgtcca tgaggacgcc gtcaccgcca atggccgcag catcggcgag      1080
     aactgccgcg attcggccat cgccgacgag gacgtcatcc ggccctatga ccggcccctg      1140
     aaggagaagg cgggcttccg cgtgctgcgc ggcaatctct tctcttccgc catcatgaag      1200
     atgagcgtca tctcgcccga gttccgcgcg cgctatctgt ccaaccccga cgatccggag      1260
     gcgttcgagg ggcgcgccgt cgtgttcgac gggccggagg actatcacgc gcgcatcgac      1320
     gatcccgcgc tggccgtcga cgagatgacg gtcctgttca tgcgcggggc cggtcccgtc      1380
     ggctatcccg gcgcggcgga agtggtgaac atgcgcgcgc ccgactacct catcaaggcg      1440
     ggcatccatt cgctgccctg catcggtgac gggcgccagt ccggcacctc cggctccccc      1500
     tccatcctca acgcctctcc cgaggcggcg gccggcggcg gcctcgcggt gctccgcacc      1560
     ggcgaccggg tgcgcatcga cctgaagcgc aacagcgccg acatgctggt gccggaagag      1620
     gagctggaac gccgccggca ggaactcgtt gcgcagggcg gctaccacta tcccgcccac      1680
     cagacgccct ggcaggagat ccagcgcggc ctggtcgggc agctcgagac cggcgcggtg      1740
     ctggaaccgg cggtgcgcta ccagcgcatc gcccagacca agggagtgcc gcgtgacaat      1800
     cactag                                                                 1806
//

If you have problems or comments...

PBIL Back to PBIL home page