(data stored in ACNUC1104 zone)

EMBL: CP002026.PE118

CP002026.PE118       Location/Qualifiers
FT   CDS_pept        complement(113723..114655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0118"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   xau:Xaut_1021 dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87455"
FT                   /db_xref="GOA:D7A0U5"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0U5"
FT                   /inference="protein motif:PFAM:PF00701"
FT                   /protein_id="ADH87455.1"
FT                   /translation="MTTSSAAGPYKGVFPVAPTVFDADGRLDLDGQKRAIDFMIDAGSH
FT                   GLCILANFSEQFVLTDEERDLVMETVLEHVGGRVPVIVTTTHFATHVCAERSRRAQEMG
FT                   AAMVMIMPPYHGATFRVPEGAIYDFYRAVCDAIDIPIMVQDAPIAGTPLSVPFLARMAK
FT                   EIEHLAYFKIEVPQAAAKLRALIEAGGDAIVGPWDGEEAITLMADLDAGATGAMTGGGY
FT                   PDGIRQIIDPYVAGDREAAVDAYMRWLPLINYENRQCGLAACKALMQEGGVIAHETLRA
FT                   PLPTLHPATRAGLIEIARRLDPLVLSWGR"
     atgacgacca gttccgccgc cggtccctat aagggcgtct tccccgtcgc accgacggtg        60
     ttcgacgccg acggccggct cgacctcgac ggccagaagc gcgccatcga cttcatgatc       120
     gacgccggct cgcacggcct gtgcatcctc gccaatttct ccgagcagtt cgtgttgacc       180
     gacgaggagc gcgacctggt gatggagacg gtgctggagc atgtcggtgg gcgggtgccg       240
     gtcatcgtca ccaccaccca tttcgccacc catgtctgcg ccgagcgctc gcgacgcgcg       300
     caggagatgg gcgcggcgat ggtaatgatc atgccgccct atcacggcgc caccttccgc       360
     gtgccggaag gagcgatcta cgatttctac cgtgccgtct gcgacgccat cgacatcccg       420
     atcatggtac aggacgcccc catcgccggc acgccgctct ccgtgccgtt cctcgcgagg       480
     atggcgaagg agatcgagca cctcgcctat ttcaagatcg aggtgccgca ggccgccgcg       540
     aaactgcgcg cgctgatcga ggccggcggc gacgcgatcg tcggcccgtg ggacggcgag       600
     gaggcgatca cgttgatggc cgacctcgac gccggcgcga ccggcgccat gaccgggggc       660
     ggctatccgg acggcatccg ccagatcatc gacccctatg tcgccggcga tcgcgaggcg       720
     gcggtcgacg cctatatgcg ctggctgccg ctgatcaatt acgagaaccg gcaatgcggc       780
     ctcgccgcct gcaaggcgct gatgcaggag ggcggcgtca tcgcccatga gacgctgcgc       840
     gcaccgctgc cgaccctgca cccggccacc cgcgccgggc tgatcgagat cgcgcgccgg       900
     ctcgatccgc tcgtgctgag ctgggggcgc tga                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page