(data stored in ACNUC1104 zone)

EMBL: CP002026.PE119

CP002026.PE119       Location/Qualifiers
FT   CDS_pept        complement(114665..116425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0119"
FT                   /product="Dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="KEGG: xau:Xaut_1022 dihydroxy-acid dehydratase;
FT                   PFAM: dihydroxy-acid and 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87456"
FT                   /db_xref="GOA:D7A0U6"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0U6"
FT                   /inference="protein motif:PRIAM:4.2.1.9"
FT                   /protein_id="ADH87456.1"
FT                   /translation="MSDDSDHGSKKPGSGRPLRSQAWFGRQDKMGFYYRSFLKNSGQPQ
FT                   DRFDGRPVIGICNTWSELTPCNGHFRDLAEHVRYGVLDAGGYPLEFPVSSLGEVTMRPT
FT                   AMLFRNLASMDVEEAIRAHPLDGVVLLMGCDKTTPALLMGAASADLPAIGVSGGPQLRG
FT                   VYRGQIIGSGTNIISMSEQLRAGEITLAEFHEAEAAMNRSAGSCMTMGTASTMASMVEA
FT                   LGIGLPENAAIPAADARRNLLARMAGRRIVEMVKEDLKPSDILTREAFENAIRTLAAIG
FT                   GSTNAVVHLLAIAGRVGVELTLADFDRLGRNIHCLVDLMPSGRFLMEDFYYAGGLPAVL
FT                   RALGERGLLHKDALTVNGSSIWENVAAAQCWNAEVITPFDAPFKAEAGIAILTGNLAPN
FT                   GAVIKPSAASPELMQHTGRAVVFESVEEMHHAVNDEALDIDADCIMVLKNCGPKGYPGM
FT                   AEVGNMPLPAKLLRAGVRDMIRISDARMSGTAYGTVVLHVAPEATAGGPLALVQNGDLI
FT                   TLDVPARSLHLHVDEAELAARRAAWVAPEPHAARGYQRLYVNHVLQADRGADFDFLVGR
FT                   SGSPVARDNH"
     atgagcgacg atagcgacca cggatcgaag aagcccggca gcggtaggcc cttgcgcagt        60
     caggcctggt tcggccggca ggacaagatg ggcttctact accgctcctt cctgaagaat       120
     tccggccagc cgcaggaccg cttcgatggt cggccggtaa tcggcatctg caacacatgg       180
     tccgagctca ccccctgcaa cggccatttc cgcgatctcg ccgagcatgt gcgctacggc       240
     gtgctggatg ccggcggcta tccgctggaa ttccccgtct cctcgctcgg cgaggtgacg       300
     atgcgcccga ccgccatgct gttccgcaac ctcgcctcga tggatgtgga ggaggccatc       360
     cgcgcccatc cgctcgacgg cgtggtgctg ctgatgggct gcgacaagac caccccggcc       420
     ctgctcatgg gcgcggcttc cgccgaccta ccggccatcg gcgtctctgg cgggccgcaa       480
     ttgcgcggcg tctatcgcgg ccagatcatc ggctcgggca ccaacatcat ctcgatgagc       540
     gagcaactgc gcgccggcga gatcacgctt gccgagttcc acgaggccga ggcggcgatg       600
     aaccgctcgg ccgggtcttg catgaccatg ggcaccgcct cgaccatggc ctcgatggtg       660
     gaagcgctcg gcatcggcct gccggagaac gccgccatcc ccgccgccga cgcaaggcgc       720
     aacctgctcg cgcgtatggc cggccggcgc atcgtcgaga tggtcaagga ggacctgaag       780
     ccctccgaca tcctcacccg cgaggctttc gagaacgcca tccgcacgct cgcggccatt       840
     ggcggctcga ccaatgcggt ggtgcatctg ctcgccatcg ccgggcgcgt cggcgtcgag       900
     ctgacgctgg ccgatttcga ccggctcggc cggaacattc actgcctcgt cgacctcatg       960
     ccgtccgggc gcttcctgat ggaggacttc tattatgccg gcggcctacc cgccgtgctg      1020
     cgcgcgctcg gcgagcgcgg cctgctccac aaggacgcac tcacggtgaa tggcagcagc      1080
     atctgggaga acgtggcagc cgcccaatgc tggaacgcgg aggtcatcac gcccttcgat      1140
     gcgccgttca aggccgaggc cggaatcgcc atcctcaccg gcaatctcgc cccgaacggg      1200
     gccgtcataa agccctccgc cgcatcgccg gaactgatgc aacacaccgg ccgcgctgtg      1260
     gtcttcgaga gcgtcgagga gatgcaccac gcggtgaacg acgaggcgct cgacatcgac      1320
     gccgactgca tcatggtgct gaagaactgc gggccgaagg gctatccggg catggccgag      1380
     gtcggcaaca tgccgctgcc ggccaagctc cttcgcgccg gcgtgcgcga catgatccgc      1440
     atctccgacg cgcgcatgtc cggcaccgcc tatggcaccg tggttctgca cgtcgcgccg      1500
     gaggcgactg ccggcgggcc gctcgctctg gtgcaaaatg gcgacctgat caccctcgac      1560
     gtccccgccc gctcgctgca tctgcatgtc gacgaggccg aactcgccgc gcgccgcgcc      1620
     gcctgggtgg cgccggagcc ccacgccgcg cgtggttatc agcgcctcta tgtcaaccat      1680
     gtgctgcagg ccgaccgcgg cgccgatttc gatttcctgg tcggacgttc cggttcgccg      1740
     gtcgcccgcg acaatcactg a                                                1761
//

If you have problems or comments...

PBIL Back to PBIL home page