(data stored in ACNUC1104 zone)

EMBL: CP002026.PE12

CP002026.PE12        Location/Qualifiers
FT   CDS_pept        7940..9658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0012"
FT                   /product="Terminase"
FT                   /note="PFAM: Terminase; KEGG: rsq:Rsph17025_1750 phage
FT                   terminase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87349"
FT                   /db_xref="InterPro:IPR005021"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZT5"
FT                   /inference="protein motif:PFAM:PF03354"
FT                   /protein_id="ADH87349.1"
FT                   /translation="MLPVLFACPDWFEKLQAGATPIPDLPIDPVLAECAVELFNKLRVP
FT                   DVPGMPTMAEAAGEWMRDIVRVAFGSVDRETGQRFVGEIFNLVPKKNGKTTNAATLGLI
FT                   WLMMNRRPNVDGIIVGPTQEVAEKCFEQASLMIAADEYLARRFKVIDHKKTIIDRHIDR
FT                   DTGIRRNAKLKIKSFDPKVVTGSIPAFAILDELHVMAHANFASRVVGQIRGGMITNPES
FT                   LLIIITTQSEVPPFGIFKQELDYARKVRDGEVTEDVRMLPILYEFPEAMQLATDKPWLD
FT                   PKNWPLVLPNLGRSLTIDRLQKEWRTAQQKGEGAAREWASQHLNVQIGTAMHGDRWVGV
FT                   DYWDAAADDRITLDYIKENSDVVVTGGDVGGLDDLWGLAVLGRHKETRHWMLWAKAWAQ
FT                   RIVLERHKEVAERLRDFEREGSLVICDRVTQDAEEAAAIIVSLRDAGLLPETGGVGLDP
FT                   AGVTALLEELALYEVGSPCVAAVSQGYRLSAAIFGTERKLADGTMKHCGSLLLNWCAGN
FT                   LMAEMRGSNVYMQKRTASAKIDPMMAAFNAVEMMSRNPVAANGPSVYEGRGILMV"
     atgctgcccg tattgttcgc ctgtcccgac tggttcgaaa agctccaggc gggcgcgacg        60
     ccaattccgg atctgccgat cgatccggtg ctggccgagt gcgcggtcga actgttcaac       120
     aagctgcgcg tgccggacgt gccgggcatg ccgaccatgg ccgaggccgc cggcgagtgg       180
     atgcgcgaca tcgtgcgcgt cgccttcggc tcggttgacc gcgagacggg gcagcgcttc       240
     gtcggcgaga tcttcaacct ggtgccgaag aaaaacggga agacgacgaa cgccgccacg       300
     ctcggcctga tctggctgat gatgaaccgg cgcccgaacg tcgacggcat catcgtcggg       360
     ccgacgcagg aggtggccga gaagtgcttc gagcaggcca gcctgatgat cgcggctgat       420
     gagtacctgg cccggcgctt caaggtgatc gaccacaaga agacgatcat cgatcgtcac       480
     atcgaccgcg acaccggcat ccgtcggaac gccaagctga agattaagag cttcgatccg       540
     aaggtggtga cgggctccat tccggcgttc gcgatcctcg acgaactgca cgttatggcc       600
     cacgcgaact tcgccagccg tgtcgtcggg cagatccgcg gcggcatgat caccaatccg       660
     gaaagcctgc tgatcatcat caccacgcag tcggaggtgc cgcccttcgg catcttcaag       720
     caggagctcg actacgcccg caaggttcgc gacggcgagg tcaccgagga cgtgcgcatg       780
     ctgccgatcc tctatgagtt tcccgaggcg atgcaactgg cgacggacaa gccttggctt       840
     gatccgaaga actggccgct ggtgctgccg aacctcggcc gctcgctgac aatcgaccgc       900
     ctgcagaagg aatggcggac ggcgcagcag aagggcgaag gcgccgcgcg cgaatgggcg       960
     tcgcagcacc tcaacgtgca gatcggcacg gcgatgcatg gggatcgctg ggtcggcgtc      1020
     gactattggg atgccgccgc cgacgaccgc atcacgctgg actacatcaa agagaattcc      1080
     gacgtcgtgg tgaccggcgg cgatgtcggc ggcctcgacg atctctgggg actggccgtc      1140
     ctcggacggc acaaggaaac ccggcactgg atgctctggg ctaaggcttg ggcgcagcgg      1200
     atcgtgctgg agcggcacaa ggaagtcgcg gagcggctac gcgacttcga gcgcgagggc      1260
     agcctcgtca tctgtgatcg ggtgacgcag gacgccgaag aggccgcagc gatcatcgtc      1320
     agcctgcgcg acgctggctt gctgccggag accggcggcg tcggtctcga cccggccggc      1380
     gtgacggccc tgctcgagga gctcgcgctc tacgaagtcg gctcgccttg cgtggcggcg      1440
     gtgagccagg gctatcgcct ctcggcggcg atcttcggca ccgagcgcaa actggcggac      1500
     ggcacgatga agcattgcgg atcgctgctg ctgaactggt gcgccggcaa cctcatggcc      1560
     gagatgcgcg gcagcaacgt ctatatgcag aagcggactg cgagcgcgaa gatcgacccg      1620
     atgatggcgg cgttcaacgc cgtcgagatg atgagccgca accctgtcgc cgccaatggt      1680
     ccgtcggtct acgaaggccg cggcattctg atggtttga                             1719
//

If you have problems or comments...

PBIL Back to PBIL home page