(data stored in ACNUC1104 zone)

EMBL: CP002026.PE120

CP002026.PE120       Location/Qualifiers
FT   CDS_pept        complement(116437..117159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0120"
FT                   /product="GntR domain protein"
FT                   /note="KEGG: bra:BRADO1811 GntR family transcriptional
FT                   regulator; PFAM: GntR domain protein; regulatory protein
FT                   GntR HTH; SMART: regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87457"
FT                   /db_xref="GOA:D7A0U7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0U7"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADH87457.1"
FT                   /translation="MTSQIIVIPARRAHSNHAEVARTIGIDIIAGRYGEGAKLPGDAEL
FT                   TLIFGVSRPVLRESVKTLVAKGLLSTKARVGTVVRERAAWNMFDPDVLAWHLDAGINKQ
FT                   FLRDLAEIRLAVEPRAAALAAERRTENDLEVMRRAVARMADEPGASSGFAEADLALHVA
FT                   VAAASGNPFMRSIGAVIEAALRASFVLSAPVDAREHGIAVAAHERIVETIADKDAEAAA
FT                   AAMTNVIFNGLRRQGATG"
     gtgacgtcgc agatcatcgt catccccgcc cgccgcgccc attccaacca tgccgaggtc        60
     gcgcgcacca tcggcatcga catcatcgcc ggccgctatg gcgagggcgc gaagcttccc       120
     ggcgatgccg agctgaccct gatcttcggc gtgtcgcggc cggtgctgcg cgagagcgtg       180
     aagacgctgg tggccaaggg cctgctctcc accaaggcgc gggtgggcac ggtggtgcgc       240
     gagcgcgcgg cctggaacat gttcgacccc gacgtgctcg cctggcacct cgacgccggc       300
     atcaacaagc agttcctgcg cgacctcgcc gagatccgcc tcgccgtcga gccgcgcgcc       360
     gcggcgctcg ccgccgagcg gcgcacggag aacgacctcg aagtgatgcg ccgggcggtc       420
     gcccggatgg ccgacgagcc cggcgcctcg agcggcttcg ccgaggccga cctcgccctc       480
     catgtcgccg ttgccgccgc ctccggcaat ccgttcatgc gctcgatcgg cgcggtgatc       540
     gaggcggcgc tgcgcgcctc cttcgtgctc tccgccccgg tcgatgcgcg cgagcacggc       600
     atcgccgtcg ccgcgcatga acgcatcgtc gagaccatcg ccgacaagga cgccgaggca       660
     gccgccgcgg cgatgacgaa cgtgatcttc aacggcctgc gccgccaggg cgcgacgggc       720
     tga                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page