(data stored in ACNUC1104 zone)

EMBL: CP002026.PE129

CP002026.PE129       Location/Qualifiers
FT   CDS_pept        complement(124399..125691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0129"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="TIGRFAM: histidinol dehydrogenase; KEGG:
FT                   rpb:RPB_4350 histidinol dehydrogenase; PFAM: Histidinol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87466"
FT                   /db_xref="GOA:D7A0V6"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0V6"
FT                   /inference="protein motif:TFAM:TIGR00069"
FT                   /protein_id="ADH87466.1"
FT                   /translation="MPLRLDTASPEFKARFTAFLGTKREVSQDVAQAVARIIDDVRARG
FT                   DDALIDFSRQFDRVDLGALGIRVTDTEIDAAEKAADPAAREALAFAHERIRSHHQRQLP
FT                   ESGRYVDAAGVELGHRWTAVDAVGLYVPGGTAAYPSSVLMNAVPAKVAGVKRVVMVVPA
FT                   PDGQINPLVLAAAKLAGVDEVYRVGGAQAVAALAYGTQTIAPVAKIVGPGNAYVAAAKR
FT                   HVFGTVGIDMVAGPSEVLVIADGAQNPDWIAADLLAQAEHDTAAQSILMTDDAALADAV
FT                   VYAVERQLTMLPRRDIAAASWAEFGAVIKLKSLDEAPALADRIAPEHLEIMAADAEALA
FT                   ERIHHAGAIFLGAHTPEAIGDYVGGSNHVLPTARSARFSSGLSVLDFMKRTSILKCGPE
FT                   QLRALGPAAIALGEAEGLSAHARSVAIRLNL"
     atgccgctcc gcctcgatac cgcctcgccc gaattcaaag cgcgcttcac ggccttcctc        60
     ggcaccaagc gcgaggtgtc gcaggacgtg gcgcaggcgg tggcgcggat catcgacgac       120
     gtgcgtgcgc gtggcgatga tgcgctgatc gacttctccc ggcagttcga ccgcgtcgac       180
     ctcggcgcgc tcggcatccg cgtcaccgac acggagatcg acgccgccga gaaggcggcc       240
     gatccggcgg cgcgcgaggc gctagccttc gcgcatgagc gcatccgttc ccatcaccag       300
     cgccagctcc cggagagcgg tcgctatgtc gacgccgccg gcgtcgagct cggccatcgc       360
     tggaccgcgg tcgacgcggt cgggctttat gtgccgggcg gcacggcggc ctatccttcc       420
     tctgtgctga tgaacgccgt gccggccaag gtcgccggcg tgaagcgcgt cgtcatggtg       480
     gtgccggcgc cggatgggca gatcaatccg ctggtgctgg cggcggcgaa gctcgccggg       540
     gtcgacgagg tctaccgcgt cggcggggcg caggcggtgg cggcgctcgc ctatgggacg       600
     cagacgatcg cgcctgtcgc caagatcgtc gggccgggca acgcttatgt cgcggcggcc       660
     aagcgccatg tcttcggcac ggtcggcatc gacatggtcg ccggcccctc cgaggtgctg       720
     gtgatcgccg acggcgcgca gaacccggac tggatcgccg ccgatctcct ggcgcaggcc       780
     gagcacgaca ccgccgccca gtcgattctg atgactgacg atgccgcgct cgctgacgct       840
     gtggtctacg cggtggagcg tcagctgacg atgctgccac gccgcgacat cgccgcggcg       900
     agctgggccg agttcggcgc ggtgatcaag ctcaagagcc tcgacgaggc gccggcgctc       960
     gccgaccgca tcgcgcccga gcacctcgag atcatggcgg ccgacgccga ggcgctggcg      1020
     gaacgcatcc accatgctgg ggcgatcttc ctcggcgccc acacgccgga agccatcggc      1080
     gactatgtcg gcggctccaa ccatgtgctg ccgaccgccc gctcggcccg cttctcctcg      1140
     gggctgagcg tgctcgattt catgaagcgg acctcgatcc tgaaatgcgg gccggagcag      1200
     cttcgcgcgc tggggccagc ggcgatcgcg ctcggcgagg cggaaggcct gagcgcacat      1260
     gcccgctcgg tcgccatccg gctcaacctc tga                                   1293
//

If you have problems or comments...

PBIL Back to PBIL home page