(data stored in ACNUC1104 zone)

EMBL: CP002026.PE130

CP002026.PE130       Location/Qualifiers
FT   CDS_pept        complement(125805..126311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0130"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azc:AZC_3150 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87467"
FT                   /db_xref="InterPro:IPR021335"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0V7"
FT                   /inference="similar to AA sequence:KEGG:AZC_3150"
FT                   /protein_id="ADH87467.1"
FT                   /translation="MAGLKLIALDAEDLAVLSVHLQDAVVSVGEMTFLPKEHRFVLLAN
FT                   RFDWEKAIQAEAMADIDTFPAGPGLAFAAAPVAAATPCVRRRSGLRFERVLNARVRGID
FT                   LTKKQGVLNLLALKFDEIDAPSGTVTFLFSGGGEVQLDVECMEAGLEDLGPAWDAKGTP
FT                   CHDVE"
     atggccggtc tcaagctgat tgcgctcgac gcagaggacc tcgcggtcct ctcggtgcat        60
     ctgcaggatg cggtggtctc ggtgggcgag atgaccttcc tgccgaagga gcaccgcttc       120
     gtgctgctcg ccaaccgctt cgattgggag aaggcgatcc aggcggaggc gatggcggat       180
     atcgacacgt tccccgccgg gccgggcctt gctttcgcgg cagccccggt ggcagccgct       240
     acgccttgcg tgcgacggcg ctcggggctc cgcttcgagc gggtgctgaa cgcgcgggtg       300
     cgcggcatcg acctcacgaa gaagcagggc gtcctgaacc tgctggcgtt gaagttcgac       360
     gagatcgacg cgccgtccgg caccgtcacc ttcctgttct ccggcggcgg cgaagtgcag       420
     ctcgacgtcg aatgcatgga agcgggcctc gaggatctcg gtcccgcctg ggacgccaag       480
     ggcacgccct gccacgacgt ggagtga                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page