(data stored in ACNUC1104 zone)

EMBL: CP002026.PE133

CP002026.PE133       Location/Qualifiers
FT   CDS_pept        complement(128515..129408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0133"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="KEGG: rlt:Rleg2_5789 transcriptional regulator, LysR
FT                   family; TIGRFAM: choline sulfate-utilization transcription
FT                   factor; PFAM: regulatory protein LysR; LysR
FT                   substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87470"
FT                   /db_xref="GOA:D7A0W0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017786"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0W0"
FT                   /inference="protein motif:TFAM:TIGR03418"
FT                   /protein_id="ADH87470.1"
FT                   /translation="MAERLLDLGWVRIFEAVGRLGSLTAAAHELGLSQPAVSYTVRNLE
FT                   RQLGTPLLERGHRGSTLSPAGERLHRAASAAVAELDAGARAIRRMSRRPVVRLFTDYGF
FT                   ASFWMMPRVAQFRLVHPDTEVHIIASAAADPGTDEAEDVAVLFGTQSDFGAGATQLFEE
FT                   CVYPVCSPHFAARHGLTDDPRAIVGLPLLHLDSTPHPRWFVWSDWFAAMHVAREPGPGD
FT                   LSLNTYGLVVQAAIADQGVALGWAGLIDGAIADGTLVAAGPALSRAESGYWMRPGREPS
FT                   APALDLIEWIIGDVRR"
     atggctgagc gccttctcga ccttggctgg gtgcggatct tcgaggccgt cggtcgcctc        60
     ggcagcctga ccgcggccgc ccatgagctc ggcctctccc agccggcggt cagctacacc       120
     gtgcgcaatc tcgaacggca gctcggcacc ccgctgctcg aacgtgggca tcgcggcagc       180
     acgctctcgc ccgccggcga gcggctgcac cgcgccgcca gcgcggcggt ggccgagctc       240
     gacgccggcg cccgcgccat aaggcgcatg agccggcgac cagtggtgcg cctcttcacc       300
     gattacggct tcgcctcgtt ctggatgatg ccgcgcgtgg cgcagttccg gctggtgcat       360
     ccggacacgg aagtccacat catcgcctcg gccgccgccg atcccggcac ggacgaggcc       420
     gaggacgtcg ccgtgctgtt cggcacgcaa tcggatttcg gcgcgggcgc cacgcagctc       480
     ttcgaggagt gcgtctatcc ggtctgcagc ccgcacttcg ctgcgcggca cgggctgacc       540
     gacgatccgc gcgccatcgt cggcctgccg ctcttgcatc tcgacagcac gccgcatccg       600
     cgctggttcg tctggagcga ctggttcgcc gccatgcatg tggcgcgcga gcccggcccg       660
     ggcgacctca gcctgaacac ctacggcctc gtggtgcagg cggcgatcgc cgaccagggc       720
     gtcgcgctcg gctgggcggg tctcatcgac ggcgccatcg ccgacggcac gctggtcgcc       780
     gccggcccgg cgctctcgcg cgccgaaagc ggctattgga tgaggcccgg ccgcgaaccg       840
     tccgccccgg cgctggacct catcgagtgg atcatagggg acgtgcgccg ctaa             894
//

If you have problems or comments...

PBIL Back to PBIL home page