(data stored in ACNUC1104 zone)

EMBL: CP002026.PE134

CP002026.PE134       Location/Qualifiers
FT   CDS_pept        129558..130499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0134"
FT                   /product="choline ABC transporter, periplasmic binding
FT                   protein"
FT                   /note="KEGG: oan:Oant_3324 substrate-binding region of
FT                   ABC-type glycine betaine transport system; TIGRFAM: choline
FT                   ABC transporter, periplasmic binding protein; PFAM:
FT                   Substrate-binding region of ABC-type glycine betaine
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87471"
FT                   /db_xref="GOA:D7A0W1"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0W1"
FT                   /inference="protein motif:TFAM:TIGR03414"
FT                   /protein_id="ADH87471.1"
FT                   /translation="MNRFVRAACALSLFLSAGAAVAADAPACKTIRMSDPGWTDITSTN
FT                   AIAGVLLSGLGYTQDVKTLSVPIGYESMKNGNLDVFLGNWMPAQRKFMDALNEAKAVEV
FT                   LATNLTGAKFTLAVPNYVAEAGVKDFKDLVANADKFGSQIYGIEPGAPANANIQKMIDA
FT                   NDFGLKGWKVVESGEQAMLAQVKRSGNGKGWIVFLAWAPHPMNETFDITYLSGGDAYFG
FT                   PNFGGADVRTLARVGWAAQCPNAATFFKNLKFDLPLENAMMGKILDEGLEPAAAAKAWL
FT                   KAHPAALEPWLAGVTTFDGKPGLPAVKASLGL"
     atgaatcgct tcgtaagggc cgcttgcgcc ctctctttat tcctctccgc cggtgccgca        60
     gtcgcggctg acgcgcccgc ctgcaagacg atccgcatgt ccgatcccgg ctggacggac       120
     atcacctcca ccaatgccat cgccggcgtg ctcttaagcg ggctcggcta cacgcaggac       180
     gtcaagacgc tctcggtgcc gatcggctac gaatcgatga agaacggcaa tctcgatgtc       240
     ttcctcggta attggatgcc ggcgcagcgg aagttcatgg atgcgctgaa cgaagccaag       300
     gcggtcgagg tgctcgccac caacctgacc ggtgccaagt tcaccctcgc cgtgccgaac       360
     tatgtcgccg aggcgggcgt gaaggacttc aaggacctcg tcgccaatgc cgacaagttc       420
     ggcagccaga tctacggcat cgagccgggt gcgccggcca atgccaacat ccagaaaatg       480
     atcgacgcca acgacttcgg cctgaagggc tggaaggtgg tggaatccgg cgagcaggcg       540
     atgctggcgc aggtcaagcg ctcgggcaac ggcaagggct ggatcgtgtt cctcgcctgg       600
     gcgccgcacc cgatgaacga gaccttcgac atcacctatc tctccggcgg cgacgcctat       660
     ttcggcccga atttcggcgg tgccgatgtg cgcactcttg cgcgcgtcgg ttgggccgcg       720
     cagtgcccca atgcggcgac cttcttcaag aacctgaagt tcgacctgcc tctggagaac       780
     gccatgatgg gcaagatcct ggacgagggg ctggagccgg ccgccgccgc caaggcgtgg       840
     ctcaaggcgc atcccgccgc gctcgaacct tggcttgccg gcgttaccac cttcgacggc       900
     aagcccggcc tgccggcggt gaaggcctcg ctcgggcttt ga                          942
//

If you have problems or comments...

PBIL Back to PBIL home page