(data stored in ACNUC1104 zone)

EMBL: CP002026.PE138

CP002026.PE138       Location/Qualifiers
FT   CDS_pept        complement(133947..135149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0138"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="KEGG: rle:RL3602 putative efflux RND transporter
FT                   protein; TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87475"
FT                   /db_xref="GOA:D7A0W5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0W5"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADH87475.1"
FT                   /translation="MNVQPGLDQFLSLEAPLPRPRRRRGLRLAALAAAVLAIGFVGVRY
FT                   FYPHAVEGEVLRPGMLDVELQGPGTLSALTEASVGSRIQARIEELAVDRNDVVAKGETL
FT                   ARLAFDDLSGEFDAAEASAHAAERTVSVAQAERDRAVATLEKARATHERQVALLAKGVA
FT                   SEAGLEDALATRRQAEADLARAGRAVEQAEAERDAATARIAVARAQLDDSVLRAPISGV
FT                   VVSRTHHVGEVLTPGSEVLHLVDPASLVLTARLDESVISAVLPGQAARVTFTRAEDPIS
FT                   GHVLRLRREVDEETREFEIDITLDTLPANWALGQRAMARIMIERRGPVLTVPTSFLVWC
FT                   DGRPGVWVATRARARWREVTLGEAGAKRVEIRRGLDAGQKILKPGDLYPFMRVRLAGPA
FT                   T"
     atgaacgtcc agcccggcct cgaccagttc ctgtcgctcg aggcgccgct cccgcgcccg        60
     cgtcgccgcc gcgggcttcg gctcgctgcc ctcgcggcgg cggtcctggc gatcgggttc       120
     gtcggcgtgc gctacttcta tccgcatgcg gtggagggcg aggttctccg gccgggcatg       180
     ctggacgtcg agcttcaggg accggggacg ctgtcggcct tgaccgaggc cagcgtcggc       240
     agccgcatcc aggcgcgcat cgaggagctc gccgtcgatc gcaacgacgt ggtcgccaag       300
     ggcgagacgc tcgcccgcct cgccttcgac gacctcagcg gcgagttcga cgctgccgag       360
     gcgagcgccc atgccgccga gcgcacggtg agcgtcgcgc aggccgaacg cgaccgcgcc       420
     gtcgcgacgc tggagaaggc gcgcgcgacg catgaaaggc aggtcgcgct gctcgccaag       480
     ggcgtcgcca gcgaggccgg gctggaagac gcgctcgcca cccgccgcca ggccgaggcg       540
     gacctcgcgc gcgccggccg cgccgtcgag caggccgagg ccgagcgcga cgccgcgacg       600
     gcgcgcatcg ccgtcgcccg cgcccagctc gacgacagcg tgctgcgtgc gccgatctcc       660
     ggcgtggtgg tgtcgcgcac gcaccatgtc ggcgaggtgc tgacgccggg cagcgaggtg       720
     ctgcacctcg tcgatcccgc cagcctcgtg ctcaccgcgc ggctggacga gagcgtcata       780
     tccgccgtcc tgccgggaca ggcggcgcgc gtcaccttca ctcgcgccga ggacccgatt       840
     tccggccatg tcctcaggct caggcgcgag gtcgacgagg agacgcggga attcgagatc       900
     gacattacgc tcgatacgct tcccgccaac tgggcgctcg gccagcgcgc catggcgcgt       960
     atcatgatcg agcggcgcgg cccggtgctg accgtgccga cgtcgttcct cgtctggtgc      1020
     gacgggcgcc ccggcgtatg ggtcgcgacc cgtgctcgcg cgcggtggcg tgaggtgacg      1080
     ctgggcgagg cgggtgcgaa gcgcgtcgaa atccggcgcg gcctcgacgc cggccagaag      1140
     atcctcaaac ccggcgacct ctacccgttt atgcgcgtgc gccttgccgg tcccgccaca      1200
     tga                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page