(data stored in ACNUC1104 zone)

EMBL: CP002026.PE14

CP002026.PE14        Location/Qualifiers
FT   CDS_pept        10984..11865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0014"
FT                   /product="peptidase S14 ClpP"
FT                   /note="PFAM: peptidase S14 ClpP; KEGG: dac:Daci_1633
FT                   peptidase S14 ClpP"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87351"
FT                   /db_xref="GOA:D6ZZT7"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZT7"
FT                   /inference="protein motif:PFAM:PF00574"
FT                   /protein_id="ADH87351.1"
FT                   /translation="MKTDRPRVMAAARPDAMPLPIRQDVHAFTKPEVFDRWSDTAAGVR
FT                   ALTVGDNVITMFDVIGEDYWSGGGVTAKKVASQLKAIGDRPVEVQINSPGGDMFEGIAI
FT                   FNVLREHPQDITVKVMGMAASAASIIAMAGDHVEMGAASFLMIHNCWVLAIGNRHDMRE
FT                   TAEWLEPFDQAMVDLYAARTSQKPADIAKWMDAETYMSGSQAVERGFADALLASDQITT
FT                   DEKAQSADRNINELRAMELQLVSAGMSRSAARARINKIKGTPGAAPNDPTPGAGEDDWS
FT                   GIADLIATLRTS"
     atgaagactg atcgtccgcg cgtgatggcc gcggcgcggc ccgatgccat gcccctgccg        60
     attcgacagg acgtgcacgc ctttaccaag ccggaagtgt tcgaccgctg gtccgacacc       120
     gccgccggcg tgcgcgccct caccgtcggc gacaacgtca tcaccatgtt cgatgtgatc       180
     ggcgaggact attggtccgg cggcggcgtc acggccaaga aggtggcatc gcagctgaag       240
     gcgatcggcg atcggcccgt cgaggtgcag atcaacagcc ccggcggcga tatgttcgaa       300
     ggcatcgcca tcttcaacgt gctgcgcgag cacccgcagg acatcacggt gaaggtgatg       360
     ggcatggcgg cctcggcggc ctcaatcatc gccatggccg gcgatcatgt cgaaatgggc       420
     gccgcgtcct tcctgatgat ccataattgc tgggtgctgg ctatcggcaa ccggcacgac       480
     atgcgcgaga ccgccgagtg gctggagccc ttcgaccagg cgatggtcga cctctacgcc       540
     gcacgcacca gccagaagcc cgccgacatc gccaagtgga tggacgccga gacctatatg       600
     tcgggctcgc aggccgtcga gcgtggcttc gcggacgcac tgctggcgtc cgaccagatc       660
     accaccgacg agaaggcgca gtccgccgac cgcaacatca acgagctgcg cgccatggaa       720
     ctgcagctcg tctccgcggg catgtcgcgc tctgccgcgc gcgcccgcat caacaagatc       780
     aagggcacgc caggcgctgc cccgaacgac cccacgccgg gcgctgggga agacgactgg       840
     tccggcattg ccgacctcat cgcaaccctc cgcacctcat ag                          882
//

If you have problems or comments...

PBIL Back to PBIL home page