(data stored in ACNUC1104 zone)

EMBL: CP002026.PE141

CP002026.PE141       Location/Qualifiers
FT   CDS_pept        136468..137793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0141"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: ara:Arad_0229 two-component sensor histidine
FT                   kinase protein; PFAM: ATP-binding region ATPase domain
FT                   protein; histidine kinase HAMP region domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87478"
FT                   /db_xref="GOA:D7A0W8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0W8"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADH87478.1"
FT                   /translation="MRLGLLARIILIVAVALFAIQLLALFFYFGAGEGRRTLGEGSPSL
FT                   SRQVASLVLLVDKVPADLRPALLEAFSENGRTATIVPALPDDFTRTNGLIRIERSIRAA
FT                   LALRGAEGRQVWARLEGRSESGRGDTLSVYVELADGGYLWLDVEDRVTVRLLGVPIGFF
FT                   AGLFGVIVALAALVAVAREMRPITRLAREVDRVGEGIDPVAIPERGAPELRKLIRAVNA
FT                   MQKRIAALVRNRTLTLGAISHDLRTYLTRLRLRVEMMPESRHRAGAIADVEAMQALVAD
FT                   TLDFAQDSFVPTEPVRADLATALRRYAAEQNDARIVLDVPDGPVHVAMGDKALGRVVAN
FT                   LVGNALRYGERAFAGIKTGGARVVLVIEDEGPGIPAEERERVFEPFHRLEASRNRDSGG
FT                   TGLGLTIVRRLVERHGGSIELGTSRRGGLAVRVMLPRTEPPA"
     atgcgcctcg gcctgctcgc ccgcatcatc ctcatcgtcg cggtggcgct tttcgccatc        60
     cagctgctgg cgctgttctt ttatttcggg gccggcgaag gccgccggac gctcggcgag       120
     ggttcgccct ccctgtcgcg gcaggtcgcg tcgctggtcc tgctggtcga caaggtgccc       180
     gccgaccttc ggcccgcttt gctcgaagcc ttcagcgaga atggccgcac cgccacgatc       240
     gtccccgctc ttcccgacga tttcacccgc accaacgggc tgatccggat cgagcggtcg       300
     atccgtgccg cattggcgct gcgcggcgcg gaggggcggc aggtctgggc gcggctcgag       360
     gggcgcagcg agagcgggcg cggcgacacg ctgagcgtct atgtcgagct cgccgacggc       420
     ggctatctct ggctcgacgt cgaggaccgc gtcaccgtcc ggctgctcgg cgtgcccatc       480
     ggcttcttcg ccggcctgtt cggcgtcatc gtcgcccttg ccgcgctggt ggcggtcgcg       540
     cgcgagatgc ggccgatcac ccgcctcgcc cgcgaggtcg accgggtggg cgagggcatc       600
     gatcccgtgg cgatacccga gcgcggcgcg ccggagttgc gcaagctgat ccgcgcggtg       660
     aacgccatgc agaagcgcat cgccgccctg gtgcgcaacc gcacgctgac gctcggcgcc       720
     atctcgcacg acctgcgcac ctatctcacc cgcctgcgcc tgcgcgtcga gatgatgccg       780
     gagagccgcc accgggccgg cgccatcgcc gatgtcgagg ccatgcaggc gctggtcgcg       840
     gacacgctcg acttcgcgca ggattccttc gtcccgacgg agccggtccg cgccgatctc       900
     gccaccgcgc tgcgccgcta cgcggccgag cagaacgatg cgcgcatcgt cctcgacgtg       960
     ccggatggcc cggtacatgt cgccatgggc gacaaggccc tcgggcgcgt cgtcgccaac      1020
     ctcgtcggca acgccttgcg ctatggcgag cgcgccttcg ccggcatcaa gacgggcggc      1080
     gcgcgtgtcg tcctggtcat agaggacgaa ggccccggca tcccggccga ggagcgcgag      1140
     cgggtcttcg agccgttcca tcggttggaa gcctcgcgca accgcgacag cggcggaacc      1200
     ggcctaggtc tgaccatcgt ccgccggctg gtcgagcggc acggcggcag catcgagctc      1260
     ggtaccagcc gccgtggcgg gcttgccgtc cgggtgatgc tgccgcggac cgagccgccg      1320
     gcctga                                                                 1326
//

If you have problems or comments...

PBIL Back to PBIL home page