(data stored in ACNUC1104 zone)

EMBL: CP002026.PE147

CP002026.PE147       Location/Qualifiers
FT   CDS_pept        complement(143105..143437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0148"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="KEGG: cti:RALTA_B0044 conserved hypothetical
FT                   protein; putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87484"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR024447"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0X4"
FT                   /inference="similar to AA sequence:KEGG:RALTA_B0044"
FT                   /protein_id="ADH87484.1"
FT                   /translation="MLSRRSLFKGLLAAALAAPAGAALTSTADAQWGVPGPRMAPPPPR
FT                   REPRPRPRRGYTWVPGHWNWSARRGWVWAPGHWEENRRGFTYVGPRWVFRRGQWVFEPG
FT                   RWVRSW"
     atgctctccc gacgctctct gttcaagggc ctcttggccg ccgccctcgc cgcaccggcc        60
     ggcgcggccc tgacctccac cgccgatgcg cagtggggtg tccccggccc tcgcatggcg       120
     ccgcctccgc cgcgccgcga gccgcgcccg cgaccgcgcc gtggctacac ctgggtgccc       180
     gggcactgga actggagcgc gcgccgaggc tgggtctggg cgcccggcca ttgggaggag       240
     aaccgccgcg gattcaccta tgtcggcccg cgctgggtat tccgccgcgg ccaatgggtg       300
     ttcgagcccg gccgctgggt ccgctcctgg tag                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page