(data stored in ACNUC1104 zone)

EMBL: CP002026.PE148

CP002026.PE148       Location/Qualifiers
FT   CDS_pept        complement(143459..144664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0149"
FT                   /product="sodium/glutamate symporter"
FT                   /note="KEGG: msl:Msil_1050 sodium/glutamate symporter;
FT                   TIGRFAM: sodium/glutamate symporter; PFAM: sodium/glutamate
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87485"
FT                   /db_xref="GOA:D7A0X5"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0X5"
FT                   /inference="protein motif:TFAM:TIGR00210"
FT                   /protein_id="ADH87485.1"
FT                   /translation="MASIQVSGLLTFTVAILVFFAGSGLNRLIAPLRAWNIPEAVTGGL
FT                   LAATVTLLAYRLLGAEISFALQARDMLLLYFFTGIGLNARLDDLISGGRPLIILLALTV
FT                   VFLVIQNFIAIGAVAALGLPEGLTVFLGSASLIGGHGTTIAWAPLISQRFGVPNAMEIG
FT                   IASATLGLVLASLAGGPIARHLIGRYKLHGPAYGDAAVGLPAKAENSPADDIGHVSLLR
FT                   TVLVLNVAILIGFGLEGVVEETGIKLPMFVVCLLVGIVLTNTVPRLFSRLLWPTRTRAL
FT                   ALVSDLSLNIFLAMSLMSMQLWTIGGLGLALVIVLAVQTVAAVAYIIFVVFPLMGRDYQ
FT                   AAVIAAGFTGISLGATPTAIANMTAITKTHGAAPRAFIILPLVSAFFIDIINAAAIGFL
FT                   AR"
     atggcgtcga tccaggtctc cggtcttctg accttcaccg tcgccatttt ggtgttcttc        60
     gccgggtccg gcctcaatcg cctgatcgca ccgctgcgcg cctggaacat ccccgaggcg       120
     gtcaccggcg gcctgctggc ggcgaccgtc acgctgctcg cctaccgcct gctcggcgcc       180
     gagatcagct tcgcgctcca ggcacgcgac atgctgctgc tctatttctt caccggcatc       240
     ggcctcaacg cccggctcga cgacctgatc tccggcgggc gccctttgat catcctgctg       300
     gcgctcaccg tcgtcttcct cgtcatccag aacttcatcg ccatcggcgc cgtcgccgcg       360
     ctcggcctgc cggaggggct caccgtcttc ctcggctccg cctcgctgat cggcgggcac       420
     ggcacgacca tcgcctgggc cccgctgatc tcccagcgat tcggcgtgcc gaacgcgatg       480
     gaaatcggca tcgcttcggc taccctcggc ctcgtgctgg cgagcctcgc cggcgggccg       540
     atcgcccgcc acctgatcgg ccgctacaag ctgcacggcc ccgcctatgg cgacgccgcg       600
     gtcggcctgc cggccaaggc ggagaattcg ccggccgacg acatcggcca tgtcagcctg       660
     ctgcgtaccg tactggtgct taacgtcgcc atattgatcg gcttcggcct ggagggcgtc       720
     gtcgaggaga ccggcatcaa gctgcccatg ttcgtggtct gcctactggt cggcatcgtg       780
     ctgaccaata ccgtcccgcg tctgttctcg cgcctgctct ggccgacgcg gacccgcgcg       840
     ctggcgctgg tctcggacct gtcgctcaac atcttcctcg ccatgtcgct gatgagcatg       900
     cagctctgga ccatcggcgg gctcggcctc gcgctcgtca tcgtgctggc ggtgcagacg       960
     gtggcggcgg tggcctacat catcttcgtc gtgttcccac tgatgggccg cgactaccag      1020
     gccgcggtga tcgccgccgg tttcacaggc atcagcctcg gcgcgacgcc gaccgccatc      1080
     gccaacatga cggcgatcac caagacgcat ggcgcggcgc cccgggcgtt catcattttg      1140
     ccgctggtct ccgcgttctt catcgacatc atcaacgcgg ccgcgatcgg attcctggcc      1200
     cgttga                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page