(data stored in ACNUC1104 zone)

EMBL: CP002026.PE15

CP002026.PE15        Location/Qualifiers
FT   CDS_pept        11875..13257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0015"
FT                   /product="phage major capsid protein, HK97 family"
FT                   /note="KEGG: bmj:BMULJ_04635 bacteriophage major capsid
FT                   protein; TIGRFAM: phage major capsid protein, HK97 family;
FT                   PFAM: major capsid protein HK97"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87352"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZT8"
FT                   /inference="protein motif:TFAM:TIGR01554"
FT                   /protein_id="ADH87352.1"
FT                   /translation="MRTFLYVALACAAVLALGHILPADASPLTHGVAMAVFAMPAAKPR
FT                   LPRIAVETTMLRPVPRAVKAMPRADVSDPKAMIAALQKAFDDFKAANDEKLKGKADVVL
FT                   DEKVDRINSAVDGFQKAIDDLNAKLAAQAAGGSVIGDLPADPEYVAAFKAHMRKGDVQA
FT                   AISKGVDSEGGYLAPVEWDRTITGKLKEVSPIRDNARVMSITTSGFKKLFTDRAVGSGW
FT                   VGETAARPATSTPAFAILDFVPGEIYANPAITQQALDDAAIDLEQWLAGEVNTEFARQE
FT                   GIAFLSGNGTNKPFGILTYVTGAANAAKHPWGAIEVVNSGAAAALTSDGFISLFYSVPT
FT                   AYRSGAKLYTNRQTMAAARKLKDGQDNYLWQPSYAQGQPATLAGEPIVEIPDMPAVAAD
FT                   AIAALYGNMEETYLVVDRIGIRVLRDPYTNKPFVHFYTTKRVGGGVFNPEPMRALKIAA
FT                   AA"
     atgcggacct tcctttacgt ggcgcttgcc tgcgccgcgg tgctggcgct cggccatatc        60
     cttcccgccg atgcttcccc gctcacccac ggcgtcgcca tggcggtctt cgccatgccc       120
     gccgccaagc cgcgcctgcc gcgtatcgcc gtcgagacca ccatgctgcg gcccgtgccg       180
     cgcgcggtga aggcgatgcc gcgcgccgac gtgagcgacc ccaaggccat gatcgcggcc       240
     ctgcagaagg cgttcgacga cttcaaggcg gcgaacgacg agaagctgaa gggcaaggcc       300
     gatgtggtgc tcgacgagaa ggtcgatcgc atcaactcgg cggtcgacgg cttccagaag       360
     gcgatcgatg atctcaatgc caagctggcc gcccaggccg ccggcggcag cgtcatcggc       420
     gacctgccgg ccgacccgga atatgtcgcc gccttcaagg cgcacatgcg caagggcgac       480
     gtgcaggcag ccatcagcaa gggcgtggat tcggagggtg gctatctggc ccccgtcgaa       540
     tgggatcgca ctatcaccgg caagctgaag gaggtctcgc ccatccgcga caatgcccgc       600
     gtgatgagca tcaccacctc cggcttcaag aagctgttca ccgatcgcgc cgtcggctcc       660
     ggctgggtcg gcgagacggc ggcccgcccg gccacctcga ccccggcctt cgcgatcctc       720
     gacttcgttc cgggcgagat ctacgccaat ccggcgatca cgcagcaggc gctggacgat       780
     gcggcgatcg atctggagca gtggctcgcg ggcgaggtca acaccgagtt cgcgcgtcag       840
     gaaggcatcg ccttcctctc cggcaacggc accaacaagc cgttcggcat cctcacctat       900
     gtgaccggcg ccgccaacgc cgccaagcat ccgtggggtg ccatcgaggt ggtgaacagc       960
     ggcgccgccg cggctctcac ttccgacggc ttcatcagcc tgttctacag cgtgccgacc      1020
     gcctatcgct ccggtgccaa gctctacacc aaccgccaga ccatggcggc ggcgcgcaag      1080
     ctgaaggacg gccaggacaa ctatctctgg cagccctcct atgcgcaggg ccagccggcg      1140
     acgctggcgg gcgagccgat cgtcgagatc cccgacatgc ccgccgtggc cgccgacgcc      1200
     atcgcggcgc tctacggcaa catggaggag acctatctgg tcgtcgaccg gatcggcatc      1260
     cgcgtgctgc gcgatcccta caccaacaag cccttcgtgc acttctacac cacgaagcgg      1320
     gtcggcggcg gcgtcttcaa tccggagccc atgcgcgctc tgaagatcgc ggctgcggcc      1380
     tag                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page