(data stored in ACNUC1104 zone)

EMBL: CP002026.PE151

CP002026.PE151       Location/Qualifiers
FT   CDS_pept        147567..149000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0152"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   mlo:mll6735 arginine/ornithine antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87488"
FT                   /db_xref="GOA:D7A0X8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004754"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0X8"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ADH87488.1"
FT                   /translation="MADPQAGKLPLPTLTAMVVGSMVGAGIFNLPGRFATATGPFGAII
FT                   AWLIAGTGMYMLARVFQALAEKRPDIDAGVFAYAKAGFGDYMGFLSAFGYWLGSCLGNV
FT                   FYWVLIGSTLGRFFPDIFGDGSSATAIIVSLVGIWAFHFMILRGVEQATFINTIVTIAK
FT                   IVPILVAVLAFVFFFNYTQFSENFFGGVGMPEKTLVAQVRDTMLITVFVFIGIEGASVY
FT                   SRYAKKRSDVGAATILGFVAVTGLMVAVTLLPYATAPRAAIAGVQNPSLAGALELVVGH
FT                   WGAVFISVGVLISVLGAYLAWSLICAEVLFAAAKSSDMPRLFAAQNANRVPANALWLTN
FT                   IVVSLFVISTYWSRDAFNFMLDMTSVTSLLPYLLVAGYGVLLARSGVGYEATPGERGRD
FT                   QIFAWIAIVYTLFMFVAAGLKYVLLVTVLFVPGTILYFWARREQQARLFTPVELVVFII
FT                   TLVGGAVGAYGLATGLITP"
     atggccgacc cgcaggcggg caaacttccg cttcccacct tgaccgccat ggtcgtcggc        60
     tcgatggtcg gggcgggcat cttcaacctt cccggccgct tcgccaccgc tacgggaccc       120
     ttcggcgcca tcatcgcctg gctgatcgcc ggcaccggca tgtacatgct ggcgcgggtc       180
     ttccaggcgc tggcagaaaa gcgaccggac atcgacgccg gtgtcttcgc ctatgccaag       240
     gccggcttcg gcgattacat gggcttcctc tcggccttcg gttactggct gggaagctgc       300
     ctcggcaacg tgttctactg ggtgctgatc gggtcgacgc tcggccgttt cttccccgac       360
     atcttcggcg acggttccag cgccaccgcg atcatcgtgt cgctggtcgg catctgggcc       420
     ttccatttca tgatcctgcg cggcgtcgag caggcgacct tcatcaacac catcgtcacc       480
     atcgccaaga tcgttccgat cctggtggcg gtcctcgcct tcgtcttctt cttcaactac       540
     acgcagttct cggagaactt cttcggcggc gtcggtatgc cggagaagac attggttgcg       600
     caggtgcgcg acaccatgct gatcacggta ttcgtgttca tcggcatcga gggcgccagc       660
     gtctattcgc gctacgccaa gaagcgctcg gatgtcggcg ccgccaccat tctcggcttc       720
     gtcgccgtca ccggcctcat ggtggccgtc accctgctgc cctatgcgac ggcgccgcgc       780
     gcggccatcg ccggcgtgca gaatccctca ctcgccggcg cgttggagct cgtcgtcggt       840
     cactggggcg cggtgttcat ctccgtcggc gtgctgatct cggtgctcgg cgcctatctc       900
     gcctggtcgc tgatctgcgc cgaggtgctg ttcgccgcgg cgaagtcgag cgacatgccg       960
     cgcctcttcg cggcgcagaa cgccaaccgc gtgccggcca acgcgctgtg gctgaccaat      1020
     atcgtcgtct cactcttcgt catctcgacc tactggtcgc gcgacgcctt caatttcatg      1080
     ctggacatga ccagcgtgac gtcgctgctg ccctatctgc tggttgccgg ctatggcgtg      1140
     ctgctggccc gcagcggcgt cggctacgag gcgacgcccg gcgagcgcgg ccgcgaccag      1200
     atcttcgcct ggatcgccat cgtctacacc ctgttcatgt tcgtcgccgc cgggctcaaa      1260
     tacgtgctgc tcgtcaccgt gctcttcgtg ccgggcacca tcctgtactt ctgggcgcgg      1320
     cgcgagcagc aggcgcggct gttcacgccg gtcgaactgg tggtcttcat cattaccctc      1380
     gtcggcggtg ctgtcggcgc ctatgggctg gccaccggcc tcatcacccc ctga            1434
//

If you have problems or comments...

PBIL Back to PBIL home page