(data stored in ACNUC1104 zone)

EMBL: CP002026.PE152

CP002026.PE152       Location/Qualifiers
FT   CDS_pept        149028..150263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0153"
FT                   /product="arginine deiminase"
FT                   /EC_number="3.5.3.6"
FT                   /note="TIGRFAM: arginine deiminase; KEGG: mlo:mll6733
FT                   arginine deiminase; PFAM: amidinotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87489"
FT                   /db_xref="GOA:D7A0X9"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0X9"
FT                   /inference="protein motif:TFAM:TIGR01078"
FT                   /protein_id="ADH87489.1"
FT                   /translation="METSFGVHSEVGQLRKVLVCAPGRAHQRLTPSNCDALLFDDVLWV
FT                   DVAKRDHFDFITKMRDRGIEVVEMHNLLTETLAVPEAKKWILDNQVAPNQIGLGFVEEV
FT                   RSYLEGLPNRQLAETLIGGLSTYEFPETIGGETLALIRDAAGVNEYLLPPLPNTLYTRD
FT                   TTCWIYGGVTLNPLYWPARHEETILTSSIYKFHPDFAGKVNVWWGDPTKDWGLATLEGG
FT                   DVMPIGKGNVLIGMSERTSRQAISQAAAALFEKGGAERVIVAAMPKLRAAMHLDTVFTF
FT                   ADRDCVLIYPDIVDKIECFSYRPDGKGGVELSRDKGLIETVKEALGLKEIRVVETGGND
FT                   YMRERTQWDSGANLVCASPGVVFAYDRNTYANTLLRKAGIEVITIDGSELGRGRGGGHC
FT                   MTCPIIRDAVDF"
     atggaaacca gtttcggcgt ccactcggag gtcggccagc tgcgcaaggt cctggtctgc        60
     gcgccgggcc gtgcgcatca gcggctgacg cccagcaatt gcgacgcgct gctgttcgac       120
     gacgtattgt gggtcgacgt tgccaagcgc gaccatttcg acttcatcac caagatgcgc       180
     gaccgcggca tcgaggtggt ggagatgcac aatctgctca ccgagacgct cgccgtcccg       240
     gaagccaaga aatggatcct cgacaaccag gtggcgccga accagatcgg cctcggcttc       300
     gtcgaggagg tgcgctccta tctcgagggc ctgccgaacc gccaactggc ggagacgctg       360
     atcggcggcc tctccaccta cgagttcccc gagaccatcg gcggcgagac gctggcgctg       420
     atccgcgacg ccgccggcgt caacgaatac ctgctgccgc cgctgcccaa cacgctctac       480
     acccgcgata cgacctgctg gatctatggc ggcgtcacgc tcaacccgct ctactggccg       540
     gcgcggcacg aggagacaat cctcaccagc tcgatctaca aattccaccc ggacttcgcg       600
     ggcaaggtga atgtctggtg gggcgacccg accaaggatt ggggcctcgc cacgctggaa       660
     ggcggcgacg tgatgccgat cggcaagggc aacgtgctga tcggcatgag cgagcgcacc       720
     tcgcgccagg ccatcagcca ggccgcggcg gcgctgttcg agaagggcgg ggcggagcgt       780
     gtcatcgtcg ccgccatgcc gaagctgcgc gcggcgatgc atctcgacac ggtgttcacc       840
     ttcgccgacc gcgactgcgt gctgatctac cccgacatcg tcgacaagat cgagtgcttc       900
     tcctaccggc cggacggcaa gggcggcgtc gagctctcca gggacaaggg cctcatcgag       960
     acggtgaagg aggctctggg cctcaaggag atccgcgtcg tcgagaccgg cggcaacgac      1020
     tatatgcgcg agcgcacgca gtgggacagc ggcgccaacc tcgtctgcgc ctcgccgggc      1080
     gtggtcttcg cctatgaccg caacacctat gccaacacgc tgctgcgcaa ggcggggatc      1140
     gaggtcatca ccatagacgg ctccgagctc ggccgcgggc gcggcggcgg ccattgcatg      1200
     acctgcccga tcatccgcga cgcggtggat ttctga                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page