(data stored in ACNUC1104 zone)

EMBL: CP002026.PE153

CP002026.PE153       Location/Qualifiers
FT   CDS_pept        complement(150280..151305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0154"
FT                   /product="Malate/L-lactate dehydrogenase"
FT                   /note="PFAM: Malate/L-lactate dehydrogenase; KEGG:
FT                   pde:Pden_4855 malate/L-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87490"
FT                   /db_xref="GOA:D7A0Y0"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/Swiss-Prot:D7A0Y0"
FT                   /inference="protein motif:PFAM:PF02615"
FT                   /protein_id="ADH87490.1"
FT                   /translation="MDEPVRLSLAEVHVLCRDTLVAAGLGEEHAQAIARSITRAEADEC
FT                   HSHGLYRLIGYVASVRSGKAERHALPALARATPAVLRVDAKHGFAPLAVETGVPALIAA
FT                   AKEIGIAALAIHDCYHFSALWADIEPAVEAGLAAWCFTVGQCCVAPAGGTTPLLGTNPF
FT                   AFGWPGPSGRPFIFDFATSAAARGEIELKRRGGEKIPPGWAVGPDGAPTTDPAAALAGA
FT                   LLPFGGHKGSALSMMVELIAGPLIGDLTSRQSKAVENGDGGPPLGGELFIAIDPAVFGT
FT                   GNLSSRLADADELFALAKAQPGVRLPSERRYQARERSRTNGIAVPAALFAELQALGPRG
FT                   S"
     gtggacgagc ccgtccgcct tagcctcgcc gaggtgcatg tgctctgccg cgacacgctg        60
     gtcgccgccg ggctcggcga agagcatgcg caggccatcg cccgctcgat cacgcgggcg       120
     gaggcggacg agtgccactc gcacgggctc taccggctga tcggctatgt cgcctcggtg       180
     cgcagcggca aggcggagcg ccacgcgcta ccggcgctgg ccagggcgac gccggcggtg       240
     ctgcgcgtcg atgcgaaaca cggcttcgcc ccgctggcgg tcgagaccgg cgtgccggcg       300
     ctgatcgcgg cggcgaaaga gatcggcatc gctgcgctcg ccatccatga ctgctaccat       360
     ttctccgcgc tctgggccga catcgagccg gcggtggagg ccgggctcgc cgcctggtgc       420
     ttcaccgtcg gccagtgctg cgtcgccccg gccggcggca cgacgccact gctcggcacc       480
     aatccctttg ccttcggctg gccggggcct tcgggtcgcc ccttcatctt cgacttcgcc       540
     accagcgccg ccgcgcgcgg cgagatcgag ctgaagcgcc gcgggggcga aaaaatcccg       600
     cccggctggg cggtcgggcc ggacggcgcg ccgaccaccg atcccgcggc cgcgctcgcc       660
     ggcgcgctgc tgcccttcgg cggccacaag ggctcggcgc tgtccatgat ggtggagttg       720
     atcgccggcc cgctgatcgg cgacctcacc agccggcaat ccaaggcggt ggagaacggc       780
     gatggcggcc cgccgctcgg cggcgagctc ttcatcgcca tcgacccggc cgtgttcggc       840
     acggggaacc tgtcctcgcg gctcgccgat gccgacgagc tcttcgccct cgccaaggcg       900
     cagcccggcg tgcgcctgcc ctcggagcgg cgctatcagg cacgcgagcg cagccgcacc       960
     aacggcatcg ccgtccccgc cgcgctcttc gccgaattgc aggccctcgg gcctcgcggg      1020
     tcctga                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page