(data stored in ACNUC1104 zone)

EMBL: CP002026.PE156

CP002026.PE156       Location/Qualifiers
FT   CDS_pept        complement(153692..154693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0157"
FT                   /product="4-hydroxyproline epimerase"
FT                   /EC_number="5.1.1.8"
FT                   /note="KEGG: sme:SM_b20268 hydroxyproline-2-epimerase;
FT                   PFAM: proline racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87493"
FT                   /db_xref="GOA:D7A0Y3"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniProtKB/Swiss-Prot:D7A0Y3"
FT                   /inference="protein motif:PRIAM:5.1.1.8"
FT                   /protein_id="ADH87493.1"
FT                   /translation="MARHSFFCIDGHTCGNPVRLVAGGGPNLQGANMIEKRAHFLAEYD
FT                   WIRTGLMFEPRGHDMMSGSILYPPTRPDCDVAILFIETSGCLPMCGHGTIGTVTMAIEH
FT                   GLVTPKIPGVLMLDTPAGVVKAEYRQEGQYVEEVRITNVPAFLYARGLTAECPGLGEVM
FT                   VDVAYGGNFYAIVEPQEHFRDMADFTAGELIGMSGALRKALNAKYEFVHPEKPEIRGLS
FT                   HILWTGAPKHAEAHARNAVFYGDKAIDRSPCGTGTSARIAHWAANGKLKVGDDFVHESI
FT                   IGSLFKGRVEATARVGNVDAIIPSIGGWARMTGYNTIFIDDRDPFAHGFVVV"
     atggcgcgac acagcttctt ctgcatagac ggccacacct gcggcaaccc cgtgcggctg        60
     gtggccggcg gcgggccgaa cctccagggc gcgaacatga tcgagaagcg cgcccacttc       120
     ctcgccgaat atgactggat ccgcaccggc ctcatgttcg agccgcgcgg ccacgacatg       180
     atgtccggct cgatcctcta tccgccgacc cggccagatt gcgacgtcgc catcctgttc       240
     atcgagacct ccggctgcct gcccatgtgc gggcacggca ccatcggcac ggtgaccatg       300
     gccatcgagc acggcctcgt cacgccgaag attccgggcg tgctcatgct cgacacgccg       360
     gccggcgtgg tgaaggccga ataccggcag gaaggccagt atgtggagga ggtgcgcatc       420
     accaacgtgc ccgccttcct ctatgcgcgc ggcctcaccg ccgaatgtcc gggcctgggc       480
     gaagtcatgg tcgacgtcgc ctatggcggg aatttctacg ccatcgtcga gccgcaggag       540
     catttccgcg acatggccga cttcaccgcc ggcgagctca tcggtatgag cggcgcgctg       600
     cgcaaggcgc tgaacgcgaa atacgagttc gtgcacccgg agaagccgga gatacgcggc       660
     ctgtcgcaca tcctctggac cggcgcgccg aagcacgccg aggcgcatgc gcgcaacgcg       720
     gtgttctacg gcgacaaggc gatcgaccgc tcgccctgcg gcaccggcac ctcggcgcgc       780
     atcgcccatt gggccgccaa cggcaagctc aaggtcggcg acgacttcgt ccacgagagc       840
     atcatcggct cgctgttcaa gggccgggtc gaggcgaccg cgcgcgtcgg caatgtcgac       900
     gccatcatcc cgtccatcgg cggctgggcc cgcatgaccg gctacaacac catcttcatc       960
     gacgaccgtg accccttcgc gcacggcttc gtggtggtct ga                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page