(data stored in ACNUC1104 zone)

EMBL: CP002026.PE16

CP002026.PE16        Location/Qualifiers
FT   CDS_pept        13324..13587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0016"
FT                   /product="neurotactin"
FT                   /note="KEGG: similar to neurotactin; K05508 C-X3-C motif
FT                   chemokine 1; K05508 C-X3-C chemokine 1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87353"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZT9"
FT                   /inference="similar to AA sequence:KEGG:100021428"
FT                   /protein_id="ADH87353.1"
FT                   /translation="MAVKKAGTARTVPVTVAAPQQAATIPAATSFAPSGAPEQTVPDVD
FT                   PKHAAIDDNPRANTSVEQNRIDFNDPTLSGSEAVANNLKGEG"
     atggcagtaa agaaggccgg caccgcccgg acggtgcccg tgaccgtcgc cgctccgcag        60
     caggcggcca ccatccccgc cgccacatcc ttcgcgcctt ctggcgcgcc ggagcagacc       120
     gtgccggatg tcgacccgaa gcacgccgcg atcgatgaca acccgcgagc gaacacgtcc       180
     gtcgaacaga accggatcga ctttaacgat ccgacgctgt ccggctccga ggcggtcgcg       240
     aataacctca agggcgaggg ttga                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page