(data stored in ACNUC1104 zone)

EMBL: CP002026.PE162

CP002026.PE162       Location/Qualifiers
FT   CDS_pept        complement(159399..160211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0163"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="KEGG: atc:AGR_L_407 probable binding protein
FT                   component of ABC transporter; PFAM: extracellular
FT                   solute-binding protein family 3; SMART: extracellular
FT                   solute-binding protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87499"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0Y9"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ADH87499.1"
FT                   /translation="MAKGIGILAAAALTLAAAMPAQADKLDDIIASGTLRCAVVLDFPP
FT                   MGSRDASNNPIGFDVDYCNDLAKVLGVKAEIVETPFPDRIPALVSGRVDVGVASTSDTL
FT                   ERAKTAGFTIPYFAFKMVVLTKDGLGIKDYDSLKGKKTGSVSGTFEALALEKDVKAWGT
FT                   GSFRGYQTQADVFLALAQGQIEATVVTSTVAAAIVKEGKYKGLMMGGDAPYDIDYVALI
FT                   ALRNEQGLINYLNLFINQQVRTGRYKALYEKWVGLGEAPNLTVPGVYR"
     atggctaagg gaatcggcat tctcgccgcg gcggcgctga cgctcgccgc tgccatgccc        60
     gcgcaggctg acaagctcga cgacatcatc gcctccggca cgctgcgctg cgccgtggtg       120
     ctggacttcc cgcccatggg atcgcgcgac gccagcaaca acccgatcgg cttcgacgtc       180
     gactactgca acgacctcgc caaggtgctg ggcgtgaagg cggagatcgt cgagaccccg       240
     ttccccgacc gcatcccggc cctcgtctcc ggccgcgtcg acgtcggcgt cgcctcgacc       300
     tccgacacgc tggagcgcgc caagaccgcc ggcttcacca tcccctactt cgccttcaag       360
     atggtggtgc tgaccaagga cgggctcggc atcaaggatt atgacagcct gaagggcaag       420
     aagaccggct cggtctccgg caccttcgag gcgctggcgc tggagaagga cgtgaaggcc       480
     tggggcaccg gctccttccg cggctaccag acccaggccg acgtgttcct ggcgctggcc       540
     cagggccaga tcgaagccac cgtcgtcacc tccaccgtcg ccgcggcgat cgtgaaggaa       600
     ggcaagtaca agggcctgat gatgggcggc gacgccccct acgacatcga ctacgtcgcg       660
     ctgatcgcgc tgcgcaacga gcaggggctg atcaactacc tcaacctgtt catcaaccag       720
     caggtccgca ccggccgcta caaggcgctc tacgagaagt gggtcggcct cggcgaggcg       780
     ccgaacctca ccgtgcccgg cgtctatcgc tga                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page