(data stored in ACNUC1104 zone)

EMBL: CP002026.PE163

CP002026.PE163       Location/Qualifiers
FT   CDS_pept        complement(160351..161160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0164"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87500"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0Z0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87500.1"
FT                   /translation="MRLSPRRLLRPRALKEADQRDTGAENVLAGEPGGLVGVAGDAGFQ
FT                   YALVLAARARHAVGQHELGTQVAVDAVQRGADGLQVVGPRGRLVERIVEAAVELAPVRG
FT                   IRLRGECIGEALGVLEPLVRDALHRIAQDFRLQQGAEFEDLADLVGRERGDHGAAVALR
FT                   RHQALLLETRQRLAHRDAADVEQAGDVVLPKGLAFGNVALGDGLAQRVENDVRRGCHLR
FT                   DVRCLNLHLVSPPGFAADRLKSPIRCRQVLCAACGFGGRRARGATAQ"
     gtgaggctca gcccccgccg cctccttcgc ccgcgtgcgc tcaaggaagc cgatcagcga        60
     gacactggcg ccgagaatgt gctcgcgggt gagccgggcg gcctcgtcgg cgtcgcgggc       120
     gatgcaggct tccaatatgc cctggtgctc gcggcgcgcg cgcgccatgc cgtcggtcag       180
     cacgagctgg gcacgcaggt agcggtcgac gcggtccagc gcggcgctga tggtctgcag       240
     gtagtagggc cgcgcggccg gctcgtagag cgaatagtgg aagctgcggt tgagctcgcc       300
     ccagtgcgag gaatccggct ccgtggagaa tgcatcggcg aagcgcttgg cgttctcgag       360
     cccctcgtcc gagatgcgct ccaccgaata gcgcaggatt tccggctcca gcagggcgcg       420
     gaattcgaag atctcgcgga tctcgtcggt cgagagcgtg gtgaccacgg cgccgcggta       480
     gcgctgcgtc gacaccaggc cctgctcctc gagacgcgtc agcgcctcgc gcaccgggat       540
     gcggctgacg ttgaacaggc gggcgatgtg gtcctgccga agggtctggc cttcggcaat       600
     gtcgcccttg gcgatggcct cgcgcagcgc gtcgaaaatg acgtccgacg cggatgccat       660
     ctgcgcgatg tccgttgcct taaccttcac ctcgtctccc ctcccggctt tgcggccgac       720
     cggcttaagt cgccgattcg ttgccggcaa gtcctttgcg cagcttgcgg tttcggcggc       780
     cggcgcgcca gaggcgccac cgcccaataa                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page