(data stored in ACNUC1104 zone)

EMBL: CP002026.PE166

CP002026.PE166       Location/Qualifiers
FT   CDS_pept        complement(163391..163993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0167"
FT                   /product="ribosomal RNA adenine methylase transferase"
FT                   /note="PFAM: ribosomal RNA adenine methylase transferase;
FT                   KEGG: mes:Meso_0915 methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87503"
FT                   /db_xref="GOA:D7A0Z3"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0Z3"
FT                   /inference="protein motif:PFAM:PF00398"
FT                   /protein_id="ADH87503.1"
FT                   /translation="MSRTATSFVDQISFLANWAGDPLRVGAIAPSGRSLADIITRGISP
FT                   ADAPVIELGAGTGAFTRALIARGVPEDRLVLIELGADFARMLKRRHPEASVLQINAAEL
FT                   ANMELFGSERAGAVVSGLPLLSFPQIAVVRILKGAFAHLREEGGFYQFTYGPVCPVPRP
FT                   ILERFGLRATKVGRTLANLPPATVYRISRRPGEALRF"
     atgagccgaa ccgccactag cttcgtcgac cagatatcct tcctcgccaa ctgggcgggc        60
     gatccgctgc gggttggcgc catcgcccct tccggccgca gcctggccga catcatcacc       120
     cgcggcatct ctcccgccga tgcgccggtg atcgagctcg gcgccggcac cggcgccttc       180
     acccgggcgc tgatcgcccg cggcgtgccg gaggaccggc tggtactgat cgagctcggc       240
     gcggatttcg cgcgcatgct caagcgccgc cacccggagg caagcgtgct gcagatcaac       300
     gccgccgaac tcgccaatat ggagctgttc ggctccgaga gggccggcgc cgtggtcagc       360
     ggcctgccgc tgctctcctt cccgcagatc gccgtggtgc gcatcctcaa gggcgccttc       420
     gcccatctgc gcgaggaggg cggcttctac caattcacct acggcccggt ctgcccggtg       480
     ccgcgcccga tattggaacg cttcgggctg cgggcaacga aggtcgggcg cacgctcgcc       540
     aacctgccgc cggccaccgt ctaccgcatc tcgcgccgcc cgggcgaggc gctgcggttc       600
     tga                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page