(data stored in ACNUC1104 zone)

EMBL: CP002026.PE168

CP002026.PE168       Location/Qualifiers
FT   CDS_pept        complement(164820..165488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0169"
FT                   /product="isoprenylcysteine carboxyl methyltransferase
FT                   protein"
FT                   /note="KEGG: ara:Arad_8431 isoprenylcysteine carboxyl
FT                   methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87505"
FT                   /db_xref="GOA:D7A0Z5"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0Z5"
FT                   /inference="similar to AA sequence:KEGG:Arad_8431"
FT                   /protein_id="ADH87505.1"
FT                   /translation="MVSYLLQCMAWTVFMAALVLLPAGTLDYPGGWAFIVLFAVGGLAM
FT                   VLWLGKYSPSLLRERMSAPWQREQKGWDKVWLTAFMLAFLAWLVFMAWDAGRTRFIAMP
FT                   AWLQVVGFLIALAYMAGVWWTFRENAFAAPVVKIQEGQKVIDTGPYAYVRHPMYTSALL
FT                   FFISLPLILGSWWGLLLAVPFVLGVAWRAVHEEEALRVGLPGYDAYAARVRYRFVPMVW
FT                   "
     atggtctcct atctcctcca gtgcatggcc tggaccgtct tcatggcagc gctggtgctg        60
     ctgccggcgg gaacgctcga ctatcccggc ggctgggcct tcatcgtgct gttcgcggtc       120
     ggcggcctcg ccatggtgct gtggttggga aaatacagcc cctcgctgct gcgcgaacgc       180
     atgtccgcgc cctggcagcg cgaacagaag gggtgggaca aggtctggct caccgccttc       240
     atgctcgcct tcctggcctg gctggtcttc atggcctggg atgccggccg tacccgcttc       300
     atcgccatgc cggcctggct gcaggtggtc ggattcctga tcgcgctcgc ctacatggcc       360
     ggcgtctggt ggacctttcg cgagaacgcc ttcgccgcgc cggtggtgaa gatccaggag       420
     ggccagaagg tcatcgacac cggcccctac gcctatgtcc gccaccccat gtataccagc       480
     gcgctcttgt tcttcatcag cctgccgctg atcctcggct cctggtgggg cctgctgctc       540
     gccgtgccgt tcgtcctcgg cgtcgcctgg cgcgcggtgc atgaggagga ggcgctgcgc       600
     gtcggcctgc ctggctacga cgcctatgcc gcgcgggtgc gctaccgttt cgtgccgatg       660
     gtctggtag                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page