(data stored in ACNUC1104 zone)

EMBL: CP002026.PE17

CP002026.PE17        Location/Qualifiers
FT   CDS_pept        13591..13908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0017"
FT                   /product="uncharacterized phage protein (putative DNA
FT                   packaging)"
FT                   /note="TIGRFAM: uncharacterized phage protein (possible DNA
FT                   packaging); KEGG: bcm:Bcenmc03_1290 phage protein DNA
FT                   packaging protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87354"
FT                   /db_xref="InterPro:IPR006450"
FT                   /db_xref="InterPro:IPR021146"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZU0"
FT                   /inference="protein motif:TFAM:TIGR01560"
FT                   /protein_id="ADH87354.1"
FT                   /translation="MPNVVVTETGPLLSLEEVKQHLRVDHGDDDALITTYMDAAVLHVL
FT                   MYCNLSLVPLGAEAQFKVAALMTAADFYDNRAEVAPGPVASVPLPASARRLVDPYRHLR
FT                   V"
     atgcccaacg tcgtcgtcac cgaaaccggc cctctgctgt ccctcgaaga ggtcaagcag        60
     cacctgcgcg tcgatcacgg tgacgacgac gcgctcatca ccacgtacat ggatgccgcc       120
     gtcctgcatg tgctgatgta ctgcaacctg tctctggtgc ctctgggcgc cgaggctcaa       180
     ttcaaggtcg ctgcgctcat gaccgcggcg gacttctacg acaaccgagc cgaggtcgcg       240
     cccggccctg tcgcttcggt gccactgccg gccagtgcgc gccgtcttgt cgacccatat       300
     cgacatctgc gagtttag                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page